SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for YKR096W from Saccharomyces cerevisiae T73

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YKR096W
Domain Number 1 Region: 260-620,711-765,792-889
Classification Level Classification E-value
Superfamily TPR-like 1.18e-52
Family Tetratricopeptide repeat (TPR) 0.036
Further Details:      
 
Weak hits

Sequence:  YKR096W
Domain Number - Region: 1028-1090,1117-1179
Classification Level Classification E-value
Superfamily PIN domain-like 0.0051
Family PIN domain 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) YKR096W
Sequence length 1196
Comment ORF Verified Protein of unknown function that may interact with ribosomes, based on co-purification experiments; green fluorescent protein (GFP)-fusion protein localizes to the nucleus and cytoplasm; predicted to contain a PINc domain
Sequence
MPETSVQNPLRLSENENTRSMFLSASQRQRPSATPSFPRLVRNTTANLSLSDFQVLNPSS
KRQNSNSVYDDINSSKRRISRPRFSDIEGKNNDHTYPERTTVKESEKNPSPRYVSSSKRV
LKRENSVGITQSSALISKSFSENGGSIAHEKWSPENMIKPLNVSQNSLAFVDAGSDEQSK
SEIVGGFQRKSNNSQEINDKDNSARDQDFNNSGNNNNNNNHSSNNNDNNNNNNDDNNNNN
NNSNSRDNNNNSDDSNERGENDSCKPASNKRSGIALIQKLQELYKVIVKQEIELQERCSQ
LTNSQTTELKSLWTIYKINTDLVNNYVTFITTALLPSQPPHDLVIGQEIVEIYRIERRLW
VYGTITFLDVLKNFSNFMDPEVCCQFITHVFVSLSTMISDIPSKYSITWLQRLGDLSRMA
IALYPSSFIDWKLSAEHWYTEAMKYIYNHGKLYYHMSTVQQNTLEAFVNLGKSVFCQETF
TPSPQYMQLVIDNIYQRAFVERNNGNLRNSLLIEYLKHSEAMLLPSFLESPDLQNVVLSY
FIEKFGIDANGCNIFNAEDMFVQNPDFFKYFFRHGPSFAQSHILQIVGFGEPKNPFAILF
ELPKYLKERKDKKERKKSSNNDSSVTESSTGNSRNDNEDDDEIMSSTTSISDHDLLAEFF
NDIDTLRRPILPSMLTNEAWLETLKFLNMTSLKCGIIVLRKFLHGPLGIALPHILPWIYF
IISICLKSSQLSDPVSKEFWMIIVKRAFPWDTMVTFMNVLIVYLLDNQTSNSIIGDLCDE
YDKLSLSELLELFNEGEELPEILGCWGTLWFDTICEKNTHSISSEDNFQEIGIKDYMALD
SPTDGIIFDEKDENGEKFWKRACRTIFLFRELSRSFPIGVIIRNDPLIYRSSFQNTNILG
SLVFKLEPLCNIHNNIPVLGALESIIDISEARSENNTDLHAVPELSVNEGDNIFHYVGYK
KLRADYTCFDKNGEFLSASLYTTWYVPNSNNTNIEDNINYNSEKENEGLFLECIKSDYPE
IDFKTTYFVFDATSWLRHSARIFKLAQNRLLRFAICLTTFQELRFLRKSKDENVMEAATR
GIITIRQLYYENKVLPLRFTGNVATHIEENLEFEEQITWRTHVDEFVIESVMKAQEKLES
ASEPRLSPRRFNYVVLISDDDAMKKKAEEKEIKTLSTRFVFSLCTKLGEQRHLCTD
Download sequence
Identical sequences YKR096W YKR096W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]