SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for YMR115W from Saccharomyces cerevisiae T73

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  YMR115W
Domain Number - Region: 126-192,432-472
Classification Level Classification E-value
Superfamily TPR-like 0.00218
Family Tetratricopeptide repeat (TPR) 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) YMR115W
Sequence length 501
Comment MGR3 ORF Verified Subunit of the mitochondrial (mt) i-AAA protease supercomplex, which degrades misfolded mitochondrial proteins; forms a subcomplex with Mgr1p that binds to substrates to facilitate proteolysis; required for growth of cells lacking mtDNA
Sequence
MLLQGMRLSQRLHKRHLFASKILTCTTNPAHIRHLHDIRPPASNFNTQESAPIPESPANS
PTRPQMAPKPNLKKKNRSLMYSIIGVSIVGLYFWFKSNSRKQKLPLSAQKVWKEAIWQES
DKMDFNYKEALRQYIEALDECDRSHVDLLSDDYTRIELKIAEMYEKLNMLEEAQNLYQEL
LSRFFEALNVPGKVDESERGEVLRKDLRILIKSLEINKDIESGKRKLLQHLLLAQEEILS
KSPELKEFFENRKKKLSMVKDINRDPNDDFKTFVSEENIKFDEQGYMILDLEKNSSAWEP
FKEEFFTARDLYTAYCLSSKDIAAALSCKITSVEWMVMADMPPGQILLSQANLGSLFYLQ
AEKLEADLNQLEQKKSKESNQELDMGTYIKAVRFVRKNRDLCLERAQKCYDSVIAFAKRN
RKIRFHVKDQLDPSIAQSIALSTYGMGVLSLHEGVLAKAEKLFKDSITMAKETEFNELLA
EAEKELEKTTVLKAAKKEGLN
Download sequence
Identical sequences YMR115W YMR115W YMR115W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]