SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|558686410|ref|YP_008824534.1| from Enterococcus mundtii QU 25

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|558686410|ref|YP_008824534.1|
Domain Number 1 Region: 1-101
Classification Level Classification E-value
Superfamily Enzyme IIa from lactose specific PTS, IIa-lac 7.85e-32
Family Enzyme IIa from lactose specific PTS, IIa-lac 0.0000601
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|558686410|ref|YP_008824534.1|
Sequence length 103
Comment PTS system, lactose/cellobiose-specific IIA component [Enterococcus mundtii QU 25]
Sequence
MNKEELQMLGFEIVAYSGDARSTLLTLLREVRQGKFDRVEEALKDADENLTLAHNSQTKI
LAEEASGKDMDMGFIFIHGQDHLMTTLLLRDLIQDFIELYKNK
Download sequence
Identical sequences A0A022N7R9 A0A1A6G567 R2MUB6 V5XNV1
gi|558686410|ref|YP_008824534.1| WP_010735223.1.23237 WP_010735223.1.37048 WP_010735223.1.40410 WP_010735223.1.43646 WP_010735223.1.541 WP_010735223.1.59274 WP_010735223.1.60249 WP_010735223.1.65236 WP_010735223.1.65483 WP_010735223.1.81882 WP_010735223.1.87464 WP_010735223.1.9890

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]