SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|568309742|ref|YP_008982011.1| from Pseudomonas aeruginosa SCV20265

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|568309742|ref|YP_008982011.1|
Domain Number 1 Region: 72-327
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 1.16e-52
Family L-arabinose binding protein-like 0.00022
Further Details:      
 
Domain Number 2 Region: 15-73
Classification Level Classification E-value
Superfamily lambda repressor-like DNA-binding domains 0.00000000000000506
Family GalR/LacI-like bacterial regulator 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|568309742|ref|YP_008982011.1|
Sequence length 343
Comment Gluconate utilization system Gnt-I transcriptional repressor [Pseudomonas aeruginosa SCV20265]
Sequence
MSITKNDKNTRTTGRPTLNEVARRAGVSPITASRALRGVASVAEELAQKVRDAARELGYV
ANPAARALASAQSHSVAVLVPSLANLLFIETLEAIHAVLRPQGLEVLIGNFHYSRNEEED
LIRNYLAYQPRGLLLTGFERTESARRMIEASGIPCVYMMDLDSGSGLNCVGFSQLRAGEA
AAEHLLARGRRRLAYIGAQLDQRTLLRGEGFRRALQKAGCYDPGLEILTPRPSSVALGGE
LFVQLLASQPQVDGVFFCNDDLAQGALLEALRRGVKVPEQIAVLGFNDLPGSDCTVPRLS
SIRTPREAIGRRAAEQLLALIAGKEVRDSALDMGFELMAREST
Download sequence
Identical sequences A0A0C7CX78 A0A0H3RCY0 A0A1E9CP02 A0A1G5LXG5 A0A1S1BVN3 Q9I1F6
gi|568154131|ref|YP_008943109.1| 208964.PA2320 557722.PLES_29851 gi|218891707|ref|YP_002440574.1| gi|386058784|ref|YP_005975306.1| gi|392984131|ref|YP_006482718.1| gi|15597516|ref|NP_251010.1| gi|514409650|ref|YP_008132853.1| NP_251010.1.87394 WP_003107131.1.100100 WP_003107131.1.100179 WP_003107131.1.100394 WP_003107131.1.100456 WP_003107131.1.100473 WP_003107131.1.100523 WP_003107131.1.100723 WP_003107131.1.100742 WP_003107131.1.100777 WP_003107131.1.100808 WP_003107131.1.100809 WP_003107131.1.100983 WP_003107131.1.101021 WP_003107131.1.101340 WP_003107131.1.101506 WP_003107131.1.101642 WP_003107131.1.101712 WP_003107131.1.10179 WP_003107131.1.101809 WP_003107131.1.10185 WP_003107131.1.101871 WP_003107131.1.10201 WP_003107131.1.10204 WP_003107131.1.10257 WP_003107131.1.1037 WP_003107131.1.10407 WP_003107131.1.10457 WP_003107131.1.10482 WP_003107131.1.10513 WP_003107131.1.10529 WP_003107131.1.10548 WP_003107131.1.10636 WP_003107131.1.10684 WP_003107131.1.10856 WP_003107131.1.10901 WP_003107131.1.10949 WP_003107131.1.11026 WP_003107131.1.11058 WP_003107131.1.1107 WP_003107131.1.1109 WP_003107131.1.11163 WP_003107131.1.11178 WP_003107131.1.11388 WP_003107131.1.11417 WP_003107131.1.11454 WP_003107131.1.11569 WP_003107131.1.11653 WP_003107131.1.11754 WP_003107131.1.1180 WP_003107131.1.1187 WP_003107131.1.11943 WP_003107131.1.12018 WP_003107131.1.12208 WP_003107131.1.12302 WP_003107131.1.12354 WP_003107131.1.1238 WP_003107131.1.12497 WP_003107131.1.12530 WP_003107131.1.12561 WP_003107131.1.12657 WP_003107131.1.12670 WP_003107131.1.12687 WP_003107131.1.12744 WP_003107131.1.12797 WP_003107131.1.12838 WP_003107131.1.12891 WP_003107131.1.12934 WP_003107131.1.12980 WP_003107131.1.13057 WP_003107131.1.13092 WP_003107131.1.13208 WP_003107131.1.13232 WP_003107131.1.13242 WP_003107131.1.13315 WP_003107131.1.1333 WP_003107131.1.13407 WP_003107131.1.13529 WP_003107131.1.13622 WP_003107131.1.13758 WP_003107131.1.13795 WP_003107131.1.13828 WP_003107131.1.13865 WP_003107131.1.1393 WP_003107131.1.14049 WP_003107131.1.14096 WP_003107131.1.14204 WP_003107131.1.14378 WP_003107131.1.14424 WP_003107131.1.14463 WP_003107131.1.14564 WP_003107131.1.14640 WP_003107131.1.14714 WP_003107131.1.1475 WP_003107131.1.14754 WP_003107131.1.14835 WP_003107131.1.14883 WP_003107131.1.14966 WP_003107131.1.15130 WP_003107131.1.152 WP_003107131.1.15222 WP_003107131.1.15231 WP_003107131.1.15281 WP_003107131.1.15297 WP_003107131.1.15379 WP_003107131.1.15480 WP_003107131.1.15482 WP_003107131.1.15602 WP_003107131.1.15692 WP_003107131.1.15886 WP_003107131.1.15889 WP_003107131.1.16041 WP_003107131.1.16074 WP_003107131.1.16142 WP_003107131.1.16161 WP_003107131.1.16239 WP_003107131.1.16279 WP_003107131.1.16419 WP_003107131.1.16660 WP_003107131.1.16694 WP_003107131.1.1670 WP_003107131.1.16808 WP_003107131.1.16895 WP_003107131.1.17155 WP_003107131.1.17162 WP_003107131.1.17353 WP_003107131.1.17354 WP_003107131.1.17370 WP_003107131.1.1739 WP_003107131.1.17397 WP_003107131.1.17697 WP_003107131.1.17890 WP_003107131.1.18052 WP_003107131.1.18199 WP_003107131.1.1824 WP_003107131.1.18547 WP_003107131.1.18653 WP_003107131.1.18728 WP_003107131.1.18735 WP_003107131.1.18852 WP_003107131.1.18892 WP_003107131.1.18911 WP_003107131.1.18930 WP_003107131.1.19260 WP_003107131.1.19269 WP_003107131.1.19376 WP_003107131.1.1938 WP_003107131.1.19552 WP_003107131.1.19591 WP_003107131.1.19741 WP_003107131.1.19803 WP_003107131.1.19931 WP_003107131.1.20024 WP_003107131.1.20134 WP_003107131.1.20216 WP_003107131.1.20342 WP_003107131.1.20682 WP_003107131.1.20854 WP_003107131.1.20929 WP_003107131.1.20978 WP_003107131.1.21100 WP_003107131.1.21166 WP_003107131.1.21302 WP_003107131.1.21349 WP_003107131.1.21358 WP_003107131.1.2144 WP_003107131.1.21469 WP_003107131.1.21517 WP_003107131.1.21607 WP_003107131.1.21718 WP_003107131.1.21744 WP_003107131.1.21767 WP_003107131.1.21782 WP_003107131.1.21801 WP_003107131.1.21863 WP_003107131.1.21871 WP_003107131.1.21891 WP_003107131.1.22078 WP_003107131.1.221 WP_003107131.1.2228 WP_003107131.1.22324 WP_003107131.1.22394 WP_003107131.1.22442 WP_003107131.1.22477 WP_003107131.1.22491 WP_003107131.1.22573 WP_003107131.1.22671 WP_003107131.1.22704 WP_003107131.1.22729 WP_003107131.1.22863 WP_003107131.1.2289 WP_003107131.1.23013 WP_003107131.1.23166 WP_003107131.1.23195 WP_003107131.1.2323 WP_003107131.1.23394 WP_003107131.1.23421 WP_003107131.1.23512 WP_003107131.1.23523 WP_003107131.1.23525 WP_003107131.1.23559 WP_003107131.1.23581 WP_003107131.1.236 WP_003107131.1.23611 WP_003107131.1.23715 WP_003107131.1.23739 WP_003107131.1.23769 WP_003107131.1.23782 WP_003107131.1.23794 WP_003107131.1.23967 WP_003107131.1.24066 WP_003107131.1.24087 WP_003107131.1.24101 WP_003107131.1.24351 WP_003107131.1.24447 WP_003107131.1.2453 WP_003107131.1.24662 WP_003107131.1.2477 WP_003107131.1.24862 WP_003107131.1.24869 WP_003107131.1.24879 WP_003107131.1.24938 WP_003107131.1.25033 WP_003107131.1.25052 WP_003107131.1.25067 WP_003107131.1.25075 WP_003107131.1.251 WP_003107131.1.25109 WP_003107131.1.2511 WP_003107131.1.25142 WP_003107131.1.25179 WP_003107131.1.25191 WP_003107131.1.25271 WP_003107131.1.2529 WP_003107131.1.25328 WP_003107131.1.25344 WP_003107131.1.2535 WP_003107131.1.25477 WP_003107131.1.25600 WP_003107131.1.25695 WP_003107131.1.25834 WP_003107131.1.25903 WP_003107131.1.2596 WP_003107131.1.25964 WP_003107131.1.26025 WP_003107131.1.26042 WP_003107131.1.26159 WP_003107131.1.26301 WP_003107131.1.26334 WP_003107131.1.26428 WP_003107131.1.26463 WP_003107131.1.26489 WP_003107131.1.2652 WP_003107131.1.26592 WP_003107131.1.26681 WP_003107131.1.26705 WP_003107131.1.26740 WP_003107131.1.26816 WP_003107131.1.26841 WP_003107131.1.26906 WP_003107131.1.26967 WP_003107131.1.27028 WP_003107131.1.27107 WP_003107131.1.27211 WP_003107131.1.27218 WP_003107131.1.27259 WP_003107131.1.27505 WP_003107131.1.27575 WP_003107131.1.27587 WP_003107131.1.27687 WP_003107131.1.27837 WP_003107131.1.27858 WP_003107131.1.27939 WP_003107131.1.27966 WP_003107131.1.28064 WP_003107131.1.28136 WP_003107131.1.28175 WP_003107131.1.28258 WP_003107131.1.283 WP_003107131.1.28316 WP_003107131.1.28329 WP_003107131.1.28372 WP_003107131.1.28382 WP_003107131.1.28383 WP_003107131.1.28404 WP_003107131.1.28528 WP_003107131.1.28560 WP_003107131.1.28602 WP_003107131.1.28838 WP_003107131.1.29062 WP_003107131.1.29096 WP_003107131.1.29137 WP_003107131.1.29158 WP_003107131.1.29179 WP_003107131.1.29401 WP_003107131.1.2941 WP_003107131.1.29438 WP_003107131.1.29472 WP_003107131.1.2948 WP_003107131.1.29481 WP_003107131.1.29498 WP_003107131.1.29501 WP_003107131.1.29577 WP_003107131.1.2961 WP_003107131.1.29753 WP_003107131.1.29767 WP_003107131.1.2980 WP_003107131.1.29848 WP_003107131.1.30000 WP_003107131.1.30081 WP_003107131.1.30254 WP_003107131.1.30365 WP_003107131.1.30474 WP_003107131.1.30475 WP_003107131.1.30614 WP_003107131.1.3072 WP_003107131.1.30740 WP_003107131.1.30797 WP_003107131.1.30815 WP_003107131.1.30973 WP_003107131.1.31045 WP_003107131.1.31076 WP_003107131.1.31103 WP_003107131.1.31147 WP_003107131.1.31279 WP_003107131.1.31501 WP_003107131.1.31565 WP_003107131.1.31741 WP_003107131.1.3179 WP_003107131.1.31848 WP_003107131.1.31852 WP_003107131.1.3189 WP_003107131.1.319 WP_003107131.1.31939 WP_003107131.1.32134 WP_003107131.1.32137 WP_003107131.1.32289 WP_003107131.1.32314 WP_003107131.1.32523 WP_003107131.1.32544 WP_003107131.1.32596 WP_003107131.1.32869 WP_003107131.1.32879 WP_003107131.1.33204 WP_003107131.1.33210 WP_003107131.1.33340 WP_003107131.1.33455 WP_003107131.1.33517 WP_003107131.1.33521 WP_003107131.1.33523 WP_003107131.1.33549 WP_003107131.1.33733 WP_003107131.1.33734 WP_003107131.1.3376 WP_003107131.1.33801 WP_003107131.1.33822 WP_003107131.1.33824 WP_003107131.1.34039 WP_003107131.1.34136 WP_003107131.1.34180 WP_003107131.1.34191 WP_003107131.1.34306 WP_003107131.1.34317 WP_003107131.1.34324 WP_003107131.1.34401 WP_003107131.1.34402 WP_003107131.1.34472 WP_003107131.1.3452 WP_003107131.1.34568 WP_003107131.1.34625 WP_003107131.1.34689 WP_003107131.1.34784 WP_003107131.1.34821 WP_003107131.1.34832 WP_003107131.1.34836 WP_003107131.1.34876 WP_003107131.1.34878 WP_003107131.1.34901 WP_003107131.1.34922 WP_003107131.1.35036 WP_003107131.1.35149 WP_003107131.1.35231 WP_003107131.1.35281 WP_003107131.1.3531 WP_003107131.1.35325 WP_003107131.1.35353 WP_003107131.1.3540 WP_003107131.1.35431 WP_003107131.1.35480 WP_003107131.1.35512 WP_003107131.1.35573 WP_003107131.1.35639 WP_003107131.1.3568 WP_003107131.1.3576 WP_003107131.1.35762 WP_003107131.1.35822 WP_003107131.1.35843 WP_003107131.1.35857 WP_003107131.1.35984 WP_003107131.1.36121 WP_003107131.1.36266 WP_003107131.1.36378 WP_003107131.1.36487 WP_003107131.1.36521 WP_003107131.1.3653 WP_003107131.1.3662 WP_003107131.1.36630 WP_003107131.1.36665 WP_003107131.1.36781 WP_003107131.1.36879 WP_003107131.1.37097 WP_003107131.1.37125 WP_003107131.1.37208 WP_003107131.1.37216 WP_003107131.1.37319 WP_003107131.1.37366 WP_003107131.1.37500 WP_003107131.1.37512 WP_003107131.1.3768 WP_003107131.1.3781 WP_003107131.1.37818 WP_003107131.1.3785 WP_003107131.1.3792 WP_003107131.1.38003 WP_003107131.1.38060 WP_003107131.1.38087 WP_003107131.1.38102 WP_003107131.1.38186 WP_003107131.1.38319 WP_003107131.1.3833 WP_003107131.1.38337 WP_003107131.1.38406 WP_003107131.1.38430 WP_003107131.1.38450 WP_003107131.1.38502 WP_003107131.1.38505 WP_003107131.1.38706 WP_003107131.1.38727 WP_003107131.1.38834 WP_003107131.1.38971 WP_003107131.1.39088 WP_003107131.1.39122 WP_003107131.1.39326 WP_003107131.1.39345 WP_003107131.1.3943 WP_003107131.1.39452 WP_003107131.1.39704 WP_003107131.1.39811 WP_003107131.1.3998 WP_003107131.1.39989 WP_003107131.1.40059 WP_003107131.1.40135 WP_003107131.1.40207 WP_003107131.1.40213 WP_003107131.1.40419 WP_003107131.1.40513 WP_003107131.1.40541 WP_003107131.1.40546 WP_003107131.1.4058 WP_003107131.1.40595 WP_003107131.1.40703 WP_003107131.1.40874 WP_003107131.1.40994 WP_003107131.1.41291 WP_003107131.1.41492 WP_003107131.1.41502 WP_003107131.1.4156 WP_003107131.1.41618 WP_003107131.1.41624 WP_003107131.1.41625 WP_003107131.1.41692 WP_003107131.1.41748 WP_003107131.1.41773 WP_003107131.1.41846 WP_003107131.1.41871 WP_003107131.1.41888 WP_003107131.1.4190 WP_003107131.1.41939 WP_003107131.1.42041 WP_003107131.1.42259 WP_003107131.1.42423 WP_003107131.1.42463 WP_003107131.1.42696 WP_003107131.1.42754 WP_003107131.1.42778 WP_003107131.1.42789 WP_003107131.1.42854 WP_003107131.1.42856 WP_003107131.1.42917 WP_003107131.1.42972 WP_003107131.1.42973 WP_003107131.1.43024 WP_003107131.1.43106 WP_003107131.1.43107 WP_003107131.1.43293 WP_003107131.1.43330 WP_003107131.1.43356 WP_003107131.1.43593 WP_003107131.1.43603 WP_003107131.1.43662 WP_003107131.1.43667 WP_003107131.1.43673 WP_003107131.1.43783 WP_003107131.1.43802 WP_003107131.1.43811 WP_003107131.1.43826 WP_003107131.1.4398 WP_003107131.1.44213 WP_003107131.1.44373 WP_003107131.1.44563 WP_003107131.1.44739 WP_003107131.1.4493 WP_003107131.1.44959 WP_003107131.1.45063 WP_003107131.1.45090 WP_003107131.1.45146 WP_003107131.1.45199 WP_003107131.1.4522 WP_003107131.1.45228 WP_003107131.1.45312 WP_003107131.1.4532 WP_003107131.1.45358 WP_003107131.1.45485 WP_003107131.1.45711 WP_003107131.1.45818 WP_003107131.1.45920 WP_003107131.1.45934 WP_003107131.1.45961 WP_003107131.1.46093 WP_003107131.1.461 WP_003107131.1.46152 WP_003107131.1.46200 WP_003107131.1.46436 WP_003107131.1.46623 WP_003107131.1.46826 WP_003107131.1.46846 WP_003107131.1.46885 WP_003107131.1.47150 WP_003107131.1.47155 WP_003107131.1.47158 WP_003107131.1.47251 WP_003107131.1.4726 WP_003107131.1.47296 WP_003107131.1.47312 WP_003107131.1.47469 WP_003107131.1.47480 WP_003107131.1.47527 WP_003107131.1.47598 WP_003107131.1.47645 WP_003107131.1.47774 WP_003107131.1.47930 WP_003107131.1.47970 WP_003107131.1.48024 WP_003107131.1.48094 WP_003107131.1.48141 WP_003107131.1.48172 WP_003107131.1.48178 WP_003107131.1.48321 WP_003107131.1.4836 WP_003107131.1.48378 WP_003107131.1.48382 WP_003107131.1.48413 WP_003107131.1.48474 WP_003107131.1.48820 WP_003107131.1.48870 WP_003107131.1.48961 WP_003107131.1.49135 WP_003107131.1.49266 WP_003107131.1.49277 WP_003107131.1.49286 WP_003107131.1.49293 WP_003107131.1.49360 WP_003107131.1.49500 WP_003107131.1.49557 WP_003107131.1.49566 WP_003107131.1.49842 WP_003107131.1.49976 WP_003107131.1.49988 WP_003107131.1.49998 WP_003107131.1.50176 WP_003107131.1.50180 WP_003107131.1.50222 WP_003107131.1.50242 WP_003107131.1.5043 WP_003107131.1.50567 WP_003107131.1.50653 WP_003107131.1.50665 WP_003107131.1.50668 WP_003107131.1.50682 WP_003107131.1.50691 WP_003107131.1.50967 WP_003107131.1.50989 WP_003107131.1.51136 WP_003107131.1.51141 WP_003107131.1.51183 WP_003107131.1.51267 WP_003107131.1.5132 WP_003107131.1.51457 WP_003107131.1.51549 WP_003107131.1.51585 WP_003107131.1.51682 WP_003107131.1.51727 WP_003107131.1.51847 WP_003107131.1.51889 WP_003107131.1.51943 WP_003107131.1.52146 WP_003107131.1.52152 WP_003107131.1.52244 WP_003107131.1.5226 WP_003107131.1.52326 WP_003107131.1.5235 WP_003107131.1.52355 WP_003107131.1.52449 WP_003107131.1.5260 WP_003107131.1.52690 WP_003107131.1.52728 WP_003107131.1.52810 WP_003107131.1.5294 WP_003107131.1.53070 WP_003107131.1.53169 WP_003107131.1.53267 WP_003107131.1.53287 WP_003107131.1.53351 WP_003107131.1.53371 WP_003107131.1.53427 WP_003107131.1.53486 WP_003107131.1.53530 WP_003107131.1.53663 WP_003107131.1.53719 WP_003107131.1.53826 WP_003107131.1.54078 WP_003107131.1.54133 WP_003107131.1.54140 WP_003107131.1.5420 WP_003107131.1.54248 WP_003107131.1.54293 WP_003107131.1.54462 WP_003107131.1.54497 WP_003107131.1.54571 WP_003107131.1.54742 WP_003107131.1.55089 WP_003107131.1.55318 WP_003107131.1.55347 WP_003107131.1.55400 WP_003107131.1.55478 WP_003107131.1.55543 WP_003107131.1.55729 WP_003107131.1.56013 WP_003107131.1.56171 WP_003107131.1.56187 WP_003107131.1.56188 WP_003107131.1.56196 WP_003107131.1.56228 WP_003107131.1.56348 WP_003107131.1.56442 WP_003107131.1.56474 WP_003107131.1.56475 WP_003107131.1.56623 WP_003107131.1.56768 WP_003107131.1.56797 WP_003107131.1.56808 WP_003107131.1.56819 WP_003107131.1.56837 WP_003107131.1.57005 WP_003107131.1.57131 WP_003107131.1.57140 WP_003107131.1.5731 WP_003107131.1.57460 WP_003107131.1.57480 WP_003107131.1.57532 WP_003107131.1.57548 WP_003107131.1.57566 WP_003107131.1.57728 WP_003107131.1.57839 WP_003107131.1.58019 WP_003107131.1.58056 WP_003107131.1.58155 WP_003107131.1.58162 WP_003107131.1.58183 WP_003107131.1.58228 WP_003107131.1.58294 WP_003107131.1.58436 WP_003107131.1.58482 WP_003107131.1.58527 WP_003107131.1.58689 WP_003107131.1.58785 WP_003107131.1.5889 WP_003107131.1.58952 WP_003107131.1.59013 WP_003107131.1.59076 WP_003107131.1.59099 WP_003107131.1.59158 WP_003107131.1.59176 WP_003107131.1.59246 WP_003107131.1.59249 WP_003107131.1.59250 WP_003107131.1.5937 WP_003107131.1.594 WP_003107131.1.59469 WP_003107131.1.59563 WP_003107131.1.59688 WP_003107131.1.59759 WP_003107131.1.59797 WP_003107131.1.59831 WP_003107131.1.59870 WP_003107131.1.60051 WP_003107131.1.60082 WP_003107131.1.60085 WP_003107131.1.60206 WP_003107131.1.60261 WP_003107131.1.60347 WP_003107131.1.60415 WP_003107131.1.60600 WP_003107131.1.60603 WP_003107131.1.60639 WP_003107131.1.60686 WP_003107131.1.607 WP_003107131.1.61191 WP_003107131.1.61222 WP_003107131.1.61299 WP_003107131.1.61366 WP_003107131.1.61431 WP_003107131.1.61493 WP_003107131.1.61549 WP_003107131.1.61696 WP_003107131.1.6173 WP_003107131.1.61943 WP_003107131.1.62010 WP_003107131.1.62035 WP_003107131.1.62180 WP_003107131.1.62186 WP_003107131.1.62357 WP_003107131.1.62396 WP_003107131.1.62410 WP_003107131.1.62516 WP_003107131.1.62534 WP_003107131.1.62635 WP_003107131.1.62688 WP_003107131.1.62701 WP_003107131.1.62704 WP_003107131.1.62716 WP_003107131.1.62772 WP_003107131.1.6280 WP_003107131.1.6283 WP_003107131.1.62834 WP_003107131.1.62838 WP_003107131.1.62917 WP_003107131.1.63057 WP_003107131.1.63124 WP_003107131.1.63193 WP_003107131.1.63196 WP_003107131.1.63338 WP_003107131.1.63369 WP_003107131.1.63634 WP_003107131.1.63659 WP_003107131.1.63995 WP_003107131.1.64139 WP_003107131.1.64340 WP_003107131.1.64433 WP_003107131.1.64591 WP_003107131.1.64603 WP_003107131.1.64726 WP_003107131.1.64748 WP_003107131.1.64799 WP_003107131.1.64854 WP_003107131.1.64880 WP_003107131.1.64885 WP_003107131.1.64983 WP_003107131.1.65066 WP_003107131.1.65092 WP_003107131.1.65095 WP_003107131.1.65099 WP_003107131.1.65196 WP_003107131.1.65197 WP_003107131.1.65227 WP_003107131.1.65237 WP_003107131.1.65247 WP_003107131.1.65304 WP_003107131.1.65316 WP_003107131.1.65334 WP_003107131.1.65335 WP_003107131.1.65549 WP_003107131.1.65588 WP_003107131.1.65867 WP_003107131.1.6589 WP_003107131.1.66062 WP_003107131.1.66165 WP_003107131.1.66277 WP_003107131.1.66345 WP_003107131.1.66348 WP_003107131.1.66364 WP_003107131.1.66526 WP_003107131.1.66634 WP_003107131.1.66721 WP_003107131.1.66892 WP_003107131.1.66931 WP_003107131.1.66945 WP_003107131.1.67010 WP_003107131.1.67388 WP_003107131.1.67531 WP_003107131.1.67545 WP_003107131.1.67686 WP_003107131.1.67903 WP_003107131.1.67948 WP_003107131.1.6808 WP_003107131.1.68158 WP_003107131.1.68162 WP_003107131.1.68183 WP_003107131.1.68317 WP_003107131.1.6850 WP_003107131.1.68561 WP_003107131.1.68568 WP_003107131.1.68638 WP_003107131.1.68800 WP_003107131.1.68857 WP_003107131.1.68862 WP_003107131.1.6928 WP_003107131.1.6931 WP_003107131.1.6937 WP_003107131.1.69534 WP_003107131.1.69599 WP_003107131.1.69788 WP_003107131.1.69791 WP_003107131.1.69819 WP_003107131.1.69834 WP_003107131.1.69907 WP_003107131.1.70098 WP_003107131.1.70216 WP_003107131.1.70229 WP_003107131.1.70460 WP_003107131.1.70561 WP_003107131.1.70648 WP_003107131.1.70670 WP_003107131.1.70693 WP_003107131.1.70831 WP_003107131.1.70991 WP_003107131.1.71141 WP_003107131.1.71385 WP_003107131.1.71570 WP_003107131.1.71666 WP_003107131.1.71799 WP_003107131.1.71806 WP_003107131.1.71822 WP_003107131.1.71891 WP_003107131.1.71934 WP_003107131.1.72149 WP_003107131.1.72323 WP_003107131.1.72331 WP_003107131.1.72346 WP_003107131.1.72378 WP_003107131.1.72447 WP_003107131.1.72541 WP_003107131.1.72562 WP_003107131.1.72570 WP_003107131.1.72653 WP_003107131.1.7276 WP_003107131.1.72772 WP_003107131.1.73135 WP_003107131.1.73149 WP_003107131.1.73172 WP_003107131.1.7329 WP_003107131.1.733 WP_003107131.1.73455 WP_003107131.1.73523 WP_003107131.1.73601 WP_003107131.1.73651 WP_003107131.1.73728 WP_003107131.1.7382 WP_003107131.1.73860 WP_003107131.1.73889 WP_003107131.1.73911 WP_003107131.1.74 WP_003107131.1.74000 WP_003107131.1.74072 WP_003107131.1.74074 WP_003107131.1.7408 WP_003107131.1.74106 WP_003107131.1.74167 WP_003107131.1.74175 WP_003107131.1.74180 WP_003107131.1.74264 WP_003107131.1.74268 WP_003107131.1.74518 WP_003107131.1.7456 WP_003107131.1.74604 WP_003107131.1.74629 WP_003107131.1.74772 WP_003107131.1.74776 WP_003107131.1.748 WP_003107131.1.74948 WP_003107131.1.75041 WP_003107131.1.75277 WP_003107131.1.75303 WP_003107131.1.7547 WP_003107131.1.75771 WP_003107131.1.75792 WP_003107131.1.75825 WP_003107131.1.75826 WP_003107131.1.75860 WP_003107131.1.75935 WP_003107131.1.75938 WP_003107131.1.75947 WP_003107131.1.76092 WP_003107131.1.76145 WP_003107131.1.76192 WP_003107131.1.76322 WP_003107131.1.76355 WP_003107131.1.76383 WP_003107131.1.76399 WP_003107131.1.76441 WP_003107131.1.76467 WP_003107131.1.76484 WP_003107131.1.76543 WP_003107131.1.7666 WP_003107131.1.76791 WP_003107131.1.76922 WP_003107131.1.76985 WP_003107131.1.77235 WP_003107131.1.77286 WP_003107131.1.77566 WP_003107131.1.77574 WP_003107131.1.77587 WP_003107131.1.77686 WP_003107131.1.77750 WP_003107131.1.77769 WP_003107131.1.7779 WP_003107131.1.77834 WP_003107131.1.78112 WP_003107131.1.78134 WP_003107131.1.78158 WP_003107131.1.78280 WP_003107131.1.78409 WP_003107131.1.78430 WP_003107131.1.78437 WP_003107131.1.78623 WP_003107131.1.78669 WP_003107131.1.78795 WP_003107131.1.788 WP_003107131.1.78810 WP_003107131.1.78926 WP_003107131.1.78954 WP_003107131.1.79007 WP_003107131.1.79177 WP_003107131.1.79193 WP_003107131.1.79256 WP_003107131.1.79357 WP_003107131.1.79364 WP_003107131.1.79429 WP_003107131.1.79431 WP_003107131.1.7945 WP_003107131.1.79463 WP_003107131.1.79507 WP_003107131.1.79544 WP_003107131.1.79631 WP_003107131.1.79788 WP_003107131.1.79862 WP_003107131.1.799 WP_003107131.1.79908 WP_003107131.1.79986 WP_003107131.1.80033 WP_003107131.1.80174 WP_003107131.1.8028 WP_003107131.1.80306 WP_003107131.1.80411 WP_003107131.1.80535 WP_003107131.1.80627 WP_003107131.1.80632 WP_003107131.1.80644 WP_003107131.1.80645 WP_003107131.1.80720 WP_003107131.1.80846 WP_003107131.1.80880 WP_003107131.1.80892 WP_003107131.1.80929 WP_003107131.1.80931 WP_003107131.1.81082 WP_003107131.1.8110 WP_003107131.1.81482 WP_003107131.1.81487 WP_003107131.1.81581 WP_003107131.1.81591 WP_003107131.1.81622 WP_003107131.1.81643 WP_003107131.1.81728 WP_003107131.1.81748 WP_003107131.1.81771 WP_003107131.1.81784 WP_003107131.1.81802 WP_003107131.1.81834 WP_003107131.1.81957 WP_003107131.1.81960 WP_003107131.1.81986 WP_003107131.1.82117 WP_003107131.1.82127 WP_003107131.1.82178 WP_003107131.1.82260 WP_003107131.1.8227 WP_003107131.1.82310 WP_003107131.1.82312 WP_003107131.1.82328 WP_003107131.1.82334 WP_003107131.1.82442 WP_003107131.1.82487 WP_003107131.1.82580 WP_003107131.1.82604 WP_003107131.1.82620 WP_003107131.1.82643 WP_003107131.1.82710 WP_003107131.1.8284 WP_003107131.1.82864 WP_003107131.1.82882 WP_003107131.1.82887 WP_003107131.1.82936 WP_003107131.1.83025 WP_003107131.1.83131 WP_003107131.1.83463 WP_003107131.1.8353 WP_003107131.1.8357 WP_003107131.1.83637 WP_003107131.1.83698 WP_003107131.1.84003 WP_003107131.1.84008 WP_003107131.1.84162 WP_003107131.1.84177 WP_003107131.1.84203 WP_003107131.1.84271 WP_003107131.1.84297 WP_003107131.1.8437 WP_003107131.1.84374 WP_003107131.1.84398 WP_003107131.1.84404 WP_003107131.1.84439 WP_003107131.1.84538 WP_003107131.1.84589 WP_003107131.1.84702 WP_003107131.1.84715 WP_003107131.1.84754 WP_003107131.1.8484 WP_003107131.1.84937 WP_003107131.1.8498 WP_003107131.1.85018 WP_003107131.1.85028 WP_003107131.1.85059 WP_003107131.1.85220 WP_003107131.1.85298 WP_003107131.1.85303 WP_003107131.1.85357 WP_003107131.1.85446 WP_003107131.1.85574 WP_003107131.1.85633 WP_003107131.1.85788 WP_003107131.1.85910 WP_003107131.1.86002 WP_003107131.1.86047 WP_003107131.1.86055 WP_003107131.1.86058 WP_003107131.1.861 WP_003107131.1.86125 WP_003107131.1.86287 WP_003107131.1.86386 WP_003107131.1.865 WP_003107131.1.86545 WP_003107131.1.86652 WP_003107131.1.867 WP_003107131.1.86708 WP_003107131.1.86733 WP_003107131.1.86774 WP_003107131.1.86780 WP_003107131.1.86785 WP_003107131.1.86947 WP_003107131.1.86985 WP_003107131.1.87163 WP_003107131.1.8718 WP_003107131.1.87183 WP_003107131.1.87390 WP_003107131.1.87435 WP_003107131.1.87530 WP_003107131.1.87547 WP_003107131.1.87970 WP_003107131.1.87987 WP_003107131.1.88004 WP_003107131.1.88308 WP_003107131.1.88330 WP_003107131.1.88360 WP_003107131.1.88388 WP_003107131.1.88517 WP_003107131.1.8852 WP_003107131.1.88550 WP_003107131.1.88578 WP_003107131.1.88605 WP_003107131.1.88659 WP_003107131.1.88679 WP_003107131.1.88680 WP_003107131.1.88750 WP_003107131.1.88796 WP_003107131.1.88900 WP_003107131.1.88949 WP_003107131.1.88969 WP_003107131.1.89083 WP_003107131.1.89098 WP_003107131.1.8911 WP_003107131.1.89234 WP_003107131.1.89266 WP_003107131.1.89434 WP_003107131.1.89440 WP_003107131.1.8949 WP_003107131.1.89491 WP_003107131.1.89610 WP_003107131.1.89669 WP_003107131.1.8976 WP_003107131.1.89776 WP_003107131.1.89867 WP_003107131.1.89886 WP_003107131.1.90024 WP_003107131.1.90032 WP_003107131.1.90056 WP_003107131.1.90110 WP_003107131.1.90141 WP_003107131.1.90150 WP_003107131.1.90189 WP_003107131.1.90224 WP_003107131.1.90225 WP_003107131.1.90268 WP_003107131.1.90655 WP_003107131.1.90770 WP_003107131.1.90940 WP_003107131.1.90999 WP_003107131.1.91161 WP_003107131.1.91204 WP_003107131.1.91336 WP_003107131.1.91360 WP_003107131.1.91416 WP_003107131.1.91431 WP_003107131.1.91438 WP_003107131.1.91563 WP_003107131.1.91585 WP_003107131.1.91803 WP_003107131.1.9182 WP_003107131.1.91838 WP_003107131.1.91846 WP_003107131.1.91860 WP_003107131.1.91862 WP_003107131.1.9191 WP_003107131.1.92175 WP_003107131.1.92321 WP_003107131.1.92357 WP_003107131.1.92454 WP_003107131.1.92585 WP_003107131.1.92587 WP_003107131.1.92589 WP_003107131.1.92624 WP_003107131.1.92642 WP_003107131.1.92769 WP_003107131.1.92839 WP_003107131.1.92847 WP_003107131.1.92894 WP_003107131.1.92924 WP_003107131.1.93090 WP_003107131.1.93144 WP_003107131.1.93148 WP_003107131.1.93250 WP_003107131.1.93446 WP_003107131.1.9349 WP_003107131.1.93498 WP_003107131.1.93547 WP_003107131.1.93562 WP_003107131.1.93797 WP_003107131.1.93848 WP_003107131.1.94031 WP_003107131.1.94136 WP_003107131.1.94174 WP_003107131.1.94211 WP_003107131.1.94218 WP_003107131.1.94243 WP_003107131.1.94285 WP_003107131.1.94385 WP_003107131.1.94434 WP_003107131.1.9444 WP_003107131.1.94450 WP_003107131.1.94814 WP_003107131.1.94856 WP_003107131.1.94874 WP_003107131.1.94896 WP_003107131.1.94897 WP_003107131.1.95056 WP_003107131.1.95217 WP_003107131.1.95305 WP_003107131.1.95324 WP_003107131.1.95359 WP_003107131.1.95460 WP_003107131.1.95488 WP_003107131.1.95536 WP_003107131.1.95638 WP_003107131.1.95668 WP_003107131.1.95774 WP_003107131.1.95787 WP_003107131.1.95802 WP_003107131.1.95959 WP_003107131.1.95994 WP_003107131.1.95999 WP_003107131.1.96008 WP_003107131.1.9604 WP_003107131.1.96041 WP_003107131.1.96134 WP_003107131.1.96193 WP_003107131.1.96357 WP_003107131.1.96384 WP_003107131.1.96434 WP_003107131.1.96452 WP_003107131.1.96506 WP_003107131.1.96667 WP_003107131.1.96702 WP_003107131.1.96714 WP_003107131.1.96880 WP_003107131.1.9706 WP_003107131.1.97126 WP_003107131.1.97213 WP_003107131.1.9722 WP_003107131.1.97271 WP_003107131.1.97272 WP_003107131.1.977 WP_003107131.1.97826 WP_003107131.1.97877 WP_003107131.1.98260 WP_003107131.1.98276 WP_003107131.1.98308 WP_003107131.1.98433 WP_003107131.1.9845 WP_003107131.1.98515 WP_003107131.1.98522 WP_003107131.1.98573 WP_003107131.1.98600 WP_003107131.1.98678 WP_003107131.1.98693 WP_003107131.1.98814 WP_003107131.1.9885 WP_003107131.1.98926 WP_003107131.1.98958 WP_003107131.1.98960 WP_003107131.1.99068 WP_003107131.1.99214 WP_003107131.1.99293 WP_003107131.1.99353 WP_003107131.1.99386 WP_003107131.1.99389 WP_003107131.1.99443 WP_003107131.1.99461 WP_003107131.1.9951 WP_003107131.1.99516 WP_003107131.1.99757 WP_003107131.1.99795 WP_003107131.1.99835 WP_003107131.1.9989 WP_003107131.1.99930 gi|568309742|ref|YP_008982011.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]