SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|568310185|ref|YP_008982454.1| from Pseudomonas aeruginosa SCV20265

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|568310185|ref|YP_008982454.1|
Domain Number 1 Region: 24-318
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 4.71e-77
Family L-arabinose binding protein-like 0.0000319
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|568310185|ref|YP_008982454.1|
Sequence length 319
Comment Ribose ABC transport system, periplasmic ribose-binding protein RbsB [Pseudomonas aeruginosa SCV20265]
Sequence
MKRVASRRLLAAVVLTACSSFLPLSAVHAETPEKPRIALVMKSLANEFFLTMEDGAKAYQ
KEHADRFELVSNGIKDETDTSSQIRIVEQMIVSGVDALVIAPADSKALVPVVKKALDAGI
VVVNIDNRFDPQVLQAKKIGVPFVGPDNRKGARLVGEYLAKRLKAGDEVGIIEGVSTTTN
AQQRTAGFRDAMDAAGMKIVSLQSGNWEIEKGNAVASAMLNEHPDLKALLAGNDSMALGA
VSAVRAAGRAGQVKVVGYDNIQAIKPMLKDGRVLATADQFAAKQAVFGIQTALKLLAGQA
PEHEKDGVVETPVELVTAP
Download sequence
Identical sequences A0A1X0SK47
WP_009315593.1.101871 WP_009315593.1.14525 WP_009315593.1.15606 WP_009315593.1.16197 WP_009315593.1.18892 WP_009315593.1.19346 WP_009315593.1.19703 WP_009315593.1.20154 WP_009315593.1.20692 WP_009315593.1.21209 WP_009315593.1.22316 WP_009315593.1.23884 WP_009315593.1.23925 WP_009315593.1.24077 WP_009315593.1.25675 WP_009315593.1.27039 WP_009315593.1.27772 WP_009315593.1.28505 WP_009315593.1.29958 WP_009315593.1.30943 WP_009315593.1.33387 WP_009315593.1.34143 WP_009315593.1.37826 WP_009315593.1.3887 WP_009315593.1.39046 WP_009315593.1.39537 WP_009315593.1.42294 WP_009315593.1.43022 WP_009315593.1.44565 WP_009315593.1.44760 WP_009315593.1.45837 WP_009315593.1.46787 WP_009315593.1.48747 WP_009315593.1.49184 WP_009315593.1.52334 WP_009315593.1.53678 WP_009315593.1.53951 WP_009315593.1.54146 WP_009315593.1.54974 WP_009315593.1.55318 WP_009315593.1.56229 WP_009315593.1.57113 WP_009315593.1.60079 WP_009315593.1.60600 WP_009315593.1.61589 WP_009315593.1.63784 WP_009315593.1.64726 WP_009315593.1.70677 WP_009315593.1.71254 WP_009315593.1.71642 WP_009315593.1.75631 WP_009315593.1.76861 WP_009315593.1.77913 WP_009315593.1.80481 WP_009315593.1.8051 WP_009315593.1.81206 WP_009315593.1.84792 WP_009315593.1.85311 WP_009315593.1.85453 WP_009315593.1.86293 WP_009315593.1.86554 WP_009315593.1.91467 WP_009315593.1.91938 WP_009315593.1.92043 WP_009315593.1.93493 WP_009315593.1.95207 WP_009315593.1.99647 gi|568310185|ref|YP_008982454.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]