SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|568311096|ref|YP_008983365.1| from Pseudomonas aeruginosa SCV20265

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|568311096|ref|YP_008983365.1|
Domain Number 1 Region: 28-366
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 9.94e-100
Family L-arabinose binding protein-like 0.00000000233
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|568311096|ref|YP_008983365.1|
Sequence length 373
Comment High-affinity leucine-specific transport system, periplasmic binding protein LivK [Pseudomonas aeruginosa SCV20265]
Sequence
MKKGTQRLSRLFAAMAIAGFASYSMAADTIKIALAGPVTGPVAQYGDMQRAGALMAIEQI
NKAGGVNGAQLEGVIYDDACDPKQAVAVANKVVNDGVKFVVGHVCSSSTQPATDIYEDEG
VLMITPSATAPEITSRGYKLIFRTIGLDNMQGPVAGKFIAERYKDKTIAVLHDKQQYGEG
IATEVKKTVEDAGIKVAVFEGLNAGDKDFNALISKLKKAGVQFVYFGGYHPEMGLLLRQA
KQAGLDARFMGPEGVGNSEITAIAGDASEGMLATLPRAFEQDPKNKTLIDAFKAKNQDPS
GIFVLPAYSAVTVIAKGIEKAGEADPEKVAEALRANTFETPTGNLGFDEKGDLKNFDFTV
YEWHKDATRTEVK
Download sequence
Identical sequences WP_023122663.1.46787 WP_023122663.1.55318 gi|568311096|ref|YP_008983365.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]