SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|568311286|ref|YP_008983555.1| from Pseudomonas aeruginosa SCV20265

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|568311286|ref|YP_008983555.1|
Domain Number 1 Region: 24-255
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.84e-51
Family Extended AAA-ATPase domain 0.00000029
Further Details:      
 
Domain Number 2 Region: 261-334
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 1.47e-25
Family Helicase DNA-binding domain 0.00087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|568311286|ref|YP_008983555.1|
Sequence length 352
Comment Holliday junction DNA helicase RuvB [Pseudomonas aeruginosa SCV20265]
Sequence
MIEPDRLISAVSGRERDEQLDRAIRPLKLADYIGQPSVREQMELFIHAARGRQEALDHTL
IFGPPGLGKTTLANIIAQEMGVSIKSTSGPVLERPGDLAALLTNLEAGDVLFVDEIHRLS
PIVEEVLYPAMEDFQLDIMIGEGPAARSIKLDLPPFTLVGATTRAGMLTNPLRDRFGIVQ
RLEFYNVEDLATIVSRSAGILGLEIEPQGAAEIAKRARGTPRIANRLLRRVRDFAEVRGQ
GDITRVIADKALNLLDVDERGFDHLDRRLLLTMIDKFDGGPVGIDNLAAALSEERHTIED
VLEPYLIQQGYIMRTPRGRVVTRHAYLHFGLNIPKRLGPGVTTDLFTSEDGN
Download sequence
Identical sequences A0A071LHH1 A0A0E1AZ15 A0A0H3QWU5 A0A157WTF4 A0A1E9CC65 A0A1F0IPL5 A0A1G5CBZ0 A0A1S1C598 B7UXW5 Q02IC9 Q51426 V6AJ38 W1MLS1
NP_249658.1.87394 WP_003086123.1.100071 WP_003086123.1.100100 WP_003086123.1.100179 WP_003086123.1.100278 WP_003086123.1.100394 WP_003086123.1.100420 WP_003086123.1.100469 WP_003086123.1.100473 WP_003086123.1.100476 WP_003086123.1.100523 WP_003086123.1.100654 WP_003086123.1.100723 WP_003086123.1.100742 WP_003086123.1.100777 WP_003086123.1.100786 WP_003086123.1.100808 WP_003086123.1.100809 WP_003086123.1.100810 WP_003086123.1.100872 WP_003086123.1.100983 WP_003086123.1.100995 WP_003086123.1.101021 WP_003086123.1.101090 WP_003086123.1.101269 WP_003086123.1.101340 WP_003086123.1.101506 WP_003086123.1.101572 WP_003086123.1.101590 WP_003086123.1.101642 WP_003086123.1.101712 WP_003086123.1.101739 WP_003086123.1.10174 WP_003086123.1.101781 WP_003086123.1.10179 WP_003086123.1.101819 WP_003086123.1.10185 WP_003086123.1.101863 WP_003086123.1.101871 WP_003086123.1.10201 WP_003086123.1.10202 WP_003086123.1.10204 WP_003086123.1.102045 WP_003086123.1.10228 WP_003086123.1.10248 WP_003086123.1.10257 WP_003086123.1.10271 WP_003086123.1.1037 WP_003086123.1.10407 WP_003086123.1.10419 WP_003086123.1.10435 WP_003086123.1.10457 WP_003086123.1.10468 WP_003086123.1.10477 WP_003086123.1.10482 WP_003086123.1.10513 WP_003086123.1.10529 WP_003086123.1.10548 WP_003086123.1.10572 WP_003086123.1.10575 WP_003086123.1.10636 WP_003086123.1.10641 WP_003086123.1.10684 WP_003086123.1.10764 WP_003086123.1.10856 WP_003086123.1.10895 WP_003086123.1.10901 WP_003086123.1.10949 WP_003086123.1.11026 WP_003086123.1.11058 WP_003086123.1.1107 WP_003086123.1.11077 WP_003086123.1.1109 WP_003086123.1.11130 WP_003086123.1.11163 WP_003086123.1.11178 WP_003086123.1.11318 WP_003086123.1.11381 WP_003086123.1.11388 WP_003086123.1.11410 WP_003086123.1.11454 WP_003086123.1.11568 WP_003086123.1.11569 WP_003086123.1.11653 WP_003086123.1.11744 WP_003086123.1.11754 WP_003086123.1.1180 WP_003086123.1.1183 WP_003086123.1.11847 WP_003086123.1.11854 WP_003086123.1.1187 WP_003086123.1.11943 WP_003086123.1.12018 WP_003086123.1.12081 WP_003086123.1.12120 WP_003086123.1.12150 WP_003086123.1.12200 WP_003086123.1.12208 WP_003086123.1.12240 WP_003086123.1.12302 WP_003086123.1.12354 WP_003086123.1.1238 WP_003086123.1.12400 WP_003086123.1.12482 WP_003086123.1.12497 WP_003086123.1.12530 WP_003086123.1.12561 WP_003086123.1.12657 WP_003086123.1.12660 WP_003086123.1.12670 WP_003086123.1.12687 WP_003086123.1.12744 WP_003086123.1.12838 WP_003086123.1.12873 WP_003086123.1.12890 WP_003086123.1.12891 WP_003086123.1.12922 WP_003086123.1.12930 WP_003086123.1.12934 WP_003086123.1.12970 WP_003086123.1.12980 WP_003086123.1.13 WP_003086123.1.13041 WP_003086123.1.1305 WP_003086123.1.13057 WP_003086123.1.13077 WP_003086123.1.13085 WP_003086123.1.13092 WP_003086123.1.13208 WP_003086123.1.13232 WP_003086123.1.13242 WP_003086123.1.13266 WP_003086123.1.13270 WP_003086123.1.13315 WP_003086123.1.1333 WP_003086123.1.13407 WP_003086123.1.13529 WP_003086123.1.13533 WP_003086123.1.1356 WP_003086123.1.1362 WP_003086123.1.13622 WP_003086123.1.13642 WP_003086123.1.13718 WP_003086123.1.13743 WP_003086123.1.13765 WP_003086123.1.13785 WP_003086123.1.13865 WP_003086123.1.1393 WP_003086123.1.14049 WP_003086123.1.14078 WP_003086123.1.14096 WP_003086123.1.14116 WP_003086123.1.14204 WP_003086123.1.14251 WP_003086123.1.14378 WP_003086123.1.14424 WP_003086123.1.14460 WP_003086123.1.14463 WP_003086123.1.14476 WP_003086123.1.14525 WP_003086123.1.14615 WP_003086123.1.14640 WP_003086123.1.14679 WP_003086123.1.14690 WP_003086123.1.14714 WP_003086123.1.1475 WP_003086123.1.14754 WP_003086123.1.14797 WP_003086123.1.14815 WP_003086123.1.14820 WP_003086123.1.14835 WP_003086123.1.14883 WP_003086123.1.14966 WP_003086123.1.14981 WP_003086123.1.15004 WP_003086123.1.15130 WP_003086123.1.1516 WP_003086123.1.152 WP_003086123.1.15222 WP_003086123.1.15231 WP_003086123.1.15281 WP_003086123.1.15297 WP_003086123.1.15328 WP_003086123.1.15373 WP_003086123.1.15379 WP_003086123.1.15408 WP_003086123.1.15474 WP_003086123.1.15480 WP_003086123.1.15482 WP_003086123.1.15485 WP_003086123.1.15602 WP_003086123.1.15606 WP_003086123.1.15666 WP_003086123.1.15692 WP_003086123.1.15886 WP_003086123.1.15889 WP_003086123.1.15934 WP_003086123.1.16041 WP_003086123.1.16074 WP_003086123.1.16109 WP_003086123.1.16142 WP_003086123.1.16161 WP_003086123.1.16197 WP_003086123.1.162 WP_003086123.1.16239 WP_003086123.1.16242 WP_003086123.1.16267 WP_003086123.1.16279 WP_003086123.1.16419 WP_003086123.1.1646 WP_003086123.1.16660 WP_003086123.1.1670 WP_003086123.1.1671 WP_003086123.1.16751 WP_003086123.1.16782 WP_003086123.1.16788 WP_003086123.1.16801 WP_003086123.1.16808 WP_003086123.1.16811 WP_003086123.1.16895 WP_003086123.1.17022 WP_003086123.1.1704 WP_003086123.1.17108 WP_003086123.1.17155 WP_003086123.1.17162 WP_003086123.1.17177 WP_003086123.1.17189 WP_003086123.1.17223 WP_003086123.1.17353 WP_003086123.1.17354 WP_003086123.1.17370 WP_003086123.1.1739 WP_003086123.1.17397 WP_003086123.1.17499 WP_003086123.1.17566 WP_003086123.1.1758 WP_003086123.1.1761 WP_003086123.1.17697 WP_003086123.1.17883 WP_003086123.1.17890 WP_003086123.1.18052 WP_003086123.1.18054 WP_003086123.1.18117 WP_003086123.1.18156 WP_003086123.1.18157 WP_003086123.1.18199 WP_003086123.1.18204 WP_003086123.1.18234 WP_003086123.1.1824 WP_003086123.1.18349 WP_003086123.1.18440 WP_003086123.1.18493 WP_003086123.1.18508 WP_003086123.1.18547 WP_003086123.1.18653 WP_003086123.1.18728 WP_003086123.1.18732 WP_003086123.1.18735 WP_003086123.1.18769 WP_003086123.1.18795 WP_003086123.1.18852 WP_003086123.1.18892 WP_003086123.1.18907 WP_003086123.1.18911 WP_003086123.1.18930 WP_003086123.1.190 WP_003086123.1.19089 WP_003086123.1.19199 WP_003086123.1.19251 WP_003086123.1.19260 WP_003086123.1.19269 WP_003086123.1.19346 WP_003086123.1.19351 WP_003086123.1.19376 WP_003086123.1.1938 WP_003086123.1.19552 WP_003086123.1.19591 WP_003086123.1.19640 WP_003086123.1.19703 WP_003086123.1.1971 WP_003086123.1.19711 WP_003086123.1.19718 WP_003086123.1.19741 WP_003086123.1.19771 WP_003086123.1.19803 WP_003086123.1.19930 WP_003086123.1.19931 WP_003086123.1.20024 WP_003086123.1.20070 WP_003086123.1.2012 WP_003086123.1.20125 WP_003086123.1.20154 WP_003086123.1.20216 WP_003086123.1.20342 WP_003086123.1.20590 WP_003086123.1.20682 WP_003086123.1.20692 WP_003086123.1.20744 WP_003086123.1.20764 WP_003086123.1.20825 WP_003086123.1.20854 WP_003086123.1.20880 WP_003086123.1.20884 WP_003086123.1.20890 WP_003086123.1.209 WP_003086123.1.20929 WP_003086123.1.20978 WP_003086123.1.21002 WP_003086123.1.21039 WP_003086123.1.21096 WP_003086123.1.21100 WP_003086123.1.21166 WP_003086123.1.21209 WP_003086123.1.21242 WP_003086123.1.21253 WP_003086123.1.21302 WP_003086123.1.21349 WP_003086123.1.21358 WP_003086123.1.2144 WP_003086123.1.21448 WP_003086123.1.21460 WP_003086123.1.21469 WP_003086123.1.21471 WP_003086123.1.21517 WP_003086123.1.21607 WP_003086123.1.21718 WP_003086123.1.2172 WP_003086123.1.21767 WP_003086123.1.21782 WP_003086123.1.21801 WP_003086123.1.21863 WP_003086123.1.21871 WP_003086123.1.21891 WP_003086123.1.21932 WP_003086123.1.22078 WP_003086123.1.221 WP_003086123.1.2228 WP_003086123.1.22316 WP_003086123.1.22324 WP_003086123.1.22365 WP_003086123.1.2237 WP_003086123.1.22389 WP_003086123.1.22390 WP_003086123.1.22394 WP_003086123.1.22442 WP_003086123.1.22477 WP_003086123.1.22491 WP_003086123.1.22573 WP_003086123.1.22671 WP_003086123.1.22704 WP_003086123.1.22729 WP_003086123.1.22863 WP_003086123.1.2289 WP_003086123.1.22891 WP_003086123.1.23013 WP_003086123.1.23166 WP_003086123.1.23191 WP_003086123.1.23195 WP_003086123.1.2323 WP_003086123.1.23264 WP_003086123.1.23331 WP_003086123.1.23394 WP_003086123.1.23418 WP_003086123.1.23421 WP_003086123.1.23512 WP_003086123.1.23523 WP_003086123.1.23525 WP_003086123.1.2355 WP_003086123.1.23559 WP_003086123.1.23581 WP_003086123.1.236 WP_003086123.1.23611 WP_003086123.1.23641 WP_003086123.1.23715 WP_003086123.1.23739 WP_003086123.1.2374 WP_003086123.1.23769 WP_003086123.1.23782 WP_003086123.1.23794 WP_003086123.1.23884 WP_003086123.1.23925 WP_003086123.1.23938 WP_003086123.1.23961 WP_003086123.1.23967 WP_003086123.1.23983 WP_003086123.1.24066 WP_003086123.1.24077 WP_003086123.1.24087 WP_003086123.1.24183 WP_003086123.1.24319 WP_003086123.1.24351 WP_003086123.1.24382 WP_003086123.1.24413 WP_003086123.1.24447 WP_003086123.1.2453 WP_003086123.1.24626 WP_003086123.1.24662 WP_003086123.1.2477 WP_003086123.1.24851 WP_003086123.1.24862 WP_003086123.1.24869 WP_003086123.1.24879 WP_003086123.1.24938 WP_003086123.1.24940 WP_003086123.1.25033 WP_003086123.1.25067 WP_003086123.1.25075 WP_003086123.1.251 WP_003086123.1.25109 WP_003086123.1.25142 WP_003086123.1.25149 WP_003086123.1.25179 WP_003086123.1.25191 WP_003086123.1.25271 WP_003086123.1.2529 WP_003086123.1.2530 WP_003086123.1.25328 WP_003086123.1.25344 WP_003086123.1.25348 WP_003086123.1.2535 WP_003086123.1.25532 WP_003086123.1.25600 WP_003086123.1.25641 WP_003086123.1.25675 WP_003086123.1.25695 WP_003086123.1.2572 WP_003086123.1.25834 WP_003086123.1.25903 WP_003086123.1.2596 WP_003086123.1.25964 WP_003086123.1.26010 WP_003086123.1.26042 WP_003086123.1.261 WP_003086123.1.26159 WP_003086123.1.26301 WP_003086123.1.26334 WP_003086123.1.26428 WP_003086123.1.26463 WP_003086123.1.26473 WP_003086123.1.26489 WP_003086123.1.2652 WP_003086123.1.26539 WP_003086123.1.26553 WP_003086123.1.26592 WP_003086123.1.26604 WP_003086123.1.26681 WP_003086123.1.26682 WP_003086123.1.26705 WP_003086123.1.26740 WP_003086123.1.26816 WP_003086123.1.26841 WP_003086123.1.26862 WP_003086123.1.26906 WP_003086123.1.26967 WP_003086123.1.2698 WP_003086123.1.27018 WP_003086123.1.27039 WP_003086123.1.27073 WP_003086123.1.27107 WP_003086123.1.27211 WP_003086123.1.27218 WP_003086123.1.27259 WP_003086123.1.27288 WP_003086123.1.27505 WP_003086123.1.27534 WP_003086123.1.27549 WP_003086123.1.27575 WP_003086123.1.27587 WP_003086123.1.27687 WP_003086123.1.27738 WP_003086123.1.27772 WP_003086123.1.27783 WP_003086123.1.27825 WP_003086123.1.27837 WP_003086123.1.27858 WP_003086123.1.27933 WP_003086123.1.27939 WP_003086123.1.27966 WP_003086123.1.28006 WP_003086123.1.28057 WP_003086123.1.28064 WP_003086123.1.28078 WP_003086123.1.28175 WP_003086123.1.28193 WP_003086123.1.28258 WP_003086123.1.283 WP_003086123.1.28316 WP_003086123.1.28329 WP_003086123.1.28372 WP_003086123.1.28382 WP_003086123.1.28404 WP_003086123.1.28468 WP_003086123.1.28505 WP_003086123.1.28528 WP_003086123.1.28560 WP_003086123.1.28602 WP_003086123.1.28623 WP_003086123.1.28699 WP_003086123.1.28713 WP_003086123.1.28757 WP_003086123.1.28800 WP_003086123.1.28823 WP_003086123.1.28838 WP_003086123.1.28849 WP_003086123.1.28878 WP_003086123.1.28920 WP_003086123.1.29003 WP_003086123.1.29008 WP_003086123.1.29062 WP_003086123.1.29070 WP_003086123.1.29096 WP_003086123.1.29127 WP_003086123.1.29137 WP_003086123.1.29158 WP_003086123.1.29179 WP_003086123.1.29208 WP_003086123.1.2927 WP_003086123.1.29401 WP_003086123.1.29438 WP_003086123.1.29440 WP_003086123.1.29472 WP_003086123.1.2948 WP_003086123.1.29481 WP_003086123.1.29498 WP_003086123.1.29501 WP_003086123.1.29577 WP_003086123.1.2961 WP_003086123.1.29633 WP_003086123.1.29650 WP_003086123.1.29668 WP_003086123.1.29753 WP_003086123.1.29767 WP_003086123.1.2980 WP_003086123.1.29848 WP_003086123.1.29920 WP_003086123.1.29958 WP_003086123.1.29973 WP_003086123.1.30000 WP_003086123.1.30020 WP_003086123.1.30081 WP_003086123.1.30120 WP_003086123.1.30254 WP_003086123.1.3030 WP_003086123.1.30365 WP_003086123.1.30474 WP_003086123.1.30475 WP_003086123.1.30563 WP_003086123.1.30567 WP_003086123.1.30614 WP_003086123.1.30615 WP_003086123.1.30625 WP_003086123.1.30693 WP_003086123.1.30707 WP_003086123.1.3072 WP_003086123.1.30740 WP_003086123.1.30797 WP_003086123.1.30815 WP_003086123.1.30842 WP_003086123.1.30886 WP_003086123.1.30943 WP_003086123.1.30994 WP_003086123.1.31045 WP_003086123.1.31076 WP_003086123.1.31087 WP_003086123.1.31103 WP_003086123.1.31105 WP_003086123.1.31138 WP_003086123.1.31147 WP_003086123.1.31279 WP_003086123.1.31361 WP_003086123.1.31457 WP_003086123.1.31501 WP_003086123.1.31563 WP_003086123.1.31565 WP_003086123.1.31587 WP_003086123.1.31633 WP_003086123.1.31655 WP_003086123.1.3172 WP_003086123.1.31732 WP_003086123.1.31741 WP_003086123.1.31751 WP_003086123.1.3179 WP_003086123.1.31852 WP_003086123.1.3189 WP_003086123.1.319 WP_003086123.1.31939 WP_003086123.1.32134 WP_003086123.1.32137 WP_003086123.1.32144 WP_003086123.1.32235 WP_003086123.1.32289 WP_003086123.1.32314 WP_003086123.1.32359 WP_003086123.1.32447 WP_003086123.1.32523 WP_003086123.1.32544 WP_003086123.1.32596 WP_003086123.1.32626 WP_003086123.1.32637 WP_003086123.1.32711 WP_003086123.1.32821 WP_003086123.1.32869 WP_003086123.1.32879 WP_003086123.1.32998 WP_003086123.1.33009 WP_003086123.1.33047 WP_003086123.1.33097 WP_003086123.1.33133 WP_003086123.1.33152 WP_003086123.1.33186 WP_003086123.1.33204 WP_003086123.1.33210 WP_003086123.1.33216 WP_003086123.1.33294 WP_003086123.1.33340 WP_003086123.1.33387 WP_003086123.1.33438 WP_003086123.1.33441 WP_003086123.1.33455 WP_003086123.1.3351 WP_003086123.1.33517 WP_003086123.1.33521 WP_003086123.1.33523 WP_003086123.1.33547 WP_003086123.1.33549 WP_003086123.1.33653 WP_003086123.1.33658 WP_003086123.1.3368 WP_003086123.1.33728 WP_003086123.1.33733 WP_003086123.1.33734 WP_003086123.1.33774 WP_003086123.1.33814 WP_003086123.1.33822 WP_003086123.1.33824 WP_003086123.1.33833 WP_003086123.1.3385 WP_003086123.1.33945 WP_003086123.1.34000 WP_003086123.1.34039 WP_003086123.1.34136 WP_003086123.1.34143 WP_003086123.1.34150 WP_003086123.1.34151 WP_003086123.1.34180 WP_003086123.1.34191 WP_003086123.1.34203 WP_003086123.1.34306 WP_003086123.1.34317 WP_003086123.1.34324 WP_003086123.1.3436 WP_003086123.1.34401 WP_003086123.1.34402 WP_003086123.1.34461 WP_003086123.1.34465 WP_003086123.1.34472 WP_003086123.1.3452 WP_003086123.1.34556 WP_003086123.1.34568 WP_003086123.1.34583 WP_003086123.1.34625 WP_003086123.1.34670 WP_003086123.1.34689 WP_003086123.1.34784 WP_003086123.1.34821 WP_003086123.1.34832 WP_003086123.1.34836 WP_003086123.1.34876 WP_003086123.1.34878 WP_003086123.1.34901 WP_003086123.1.34922 WP_003086123.1.34942 WP_003086123.1.35036 WP_003086123.1.35104 WP_003086123.1.35149 WP_003086123.1.35231 WP_003086123.1.35281 WP_003086123.1.3531 WP_003086123.1.35325 WP_003086123.1.35353 WP_003086123.1.3540 WP_003086123.1.35431 WP_003086123.1.35442 WP_003086123.1.35480 WP_003086123.1.35512 WP_003086123.1.35529 WP_003086123.1.3555 WP_003086123.1.35573 WP_003086123.1.35599 WP_003086123.1.35639 WP_003086123.1.35641 WP_003086123.1.35669 WP_003086123.1.35679 WP_003086123.1.3568 WP_003086123.1.35682 WP_003086123.1.3576 WP_003086123.1.35762 WP_003086123.1.35768 WP_003086123.1.35822 WP_003086123.1.35843 WP_003086123.1.35857 WP_003086123.1.35872 WP_003086123.1.35968 WP_003086123.1.35984 WP_003086123.1.36064 WP_003086123.1.36121 WP_003086123.1.36148 WP_003086123.1.36170 WP_003086123.1.36267 WP_003086123.1.36285 WP_003086123.1.36378 WP_003086123.1.36435 WP_003086123.1.36487 WP_003086123.1.36521 WP_003086123.1.3653 WP_003086123.1.36587 WP_003086123.1.36608 WP_003086123.1.3662 WP_003086123.1.36630 WP_003086123.1.36665 WP_003086123.1.36708 WP_003086123.1.3672 WP_003086123.1.36756 WP_003086123.1.36781 WP_003086123.1.36879 WP_003086123.1.37050 WP_003086123.1.37097 WP_003086123.1.37125 WP_003086123.1.37163 WP_003086123.1.37172 WP_003086123.1.3721 WP_003086123.1.37216 WP_003086123.1.373 WP_003086123.1.37319 WP_003086123.1.37366 WP_003086123.1.37416 WP_003086123.1.3742 WP_003086123.1.37500 WP_003086123.1.37512 WP_003086123.1.37571 WP_003086123.1.3768 WP_003086123.1.37698 WP_003086123.1.37703 WP_003086123.1.3773 WP_003086123.1.3781 WP_003086123.1.37814 WP_003086123.1.37826 WP_003086123.1.37842 WP_003086123.1.38003 WP_003086123.1.38023 WP_003086123.1.38060 WP_003086123.1.38087 WP_003086123.1.38102 WP_003086123.1.38146 WP_003086123.1.38151 WP_003086123.1.3818 WP_003086123.1.38186 WP_003086123.1.3821 WP_003086123.1.38319 WP_003086123.1.3833 WP_003086123.1.38335 WP_003086123.1.38337 WP_003086123.1.38406 WP_003086123.1.38430 WP_003086123.1.38450 WP_003086123.1.38502 WP_003086123.1.38510 WP_003086123.1.38582 WP_003086123.1.38583 WP_003086123.1.38587 WP_003086123.1.38657 WP_003086123.1.38661 WP_003086123.1.3870 WP_003086123.1.38706 WP_003086123.1.38727 WP_003086123.1.38816 WP_003086123.1.38834 WP_003086123.1.3887 WP_003086123.1.38889 WP_003086123.1.38932 WP_003086123.1.38971 WP_003086123.1.39046 WP_003086123.1.39088 WP_003086123.1.39122 WP_003086123.1.39186 WP_003086123.1.39271 WP_003086123.1.39326 WP_003086123.1.39345 WP_003086123.1.3943 WP_003086123.1.39444 WP_003086123.1.39452 WP_003086123.1.39537 WP_003086123.1.39704 WP_003086123.1.39765 WP_003086123.1.39786 WP_003086123.1.39811 WP_003086123.1.39920 WP_003086123.1.39949 WP_003086123.1.3998 WP_003086123.1.39989 WP_003086123.1.40059 WP_003086123.1.40115 WP_003086123.1.40135 WP_003086123.1.40207 WP_003086123.1.40213 WP_003086123.1.40237 WP_003086123.1.40243 WP_003086123.1.40271 WP_003086123.1.40419 WP_003086123.1.40442 WP_003086123.1.40512 WP_003086123.1.40513 WP_003086123.1.40541 WP_003086123.1.40546 WP_003086123.1.4058 WP_003086123.1.40595 WP_003086123.1.40703 WP_003086123.1.40874 WP_003086123.1.40950 WP_003086123.1.40984 WP_003086123.1.40993 WP_003086123.1.40994 WP_003086123.1.41110 WP_003086123.1.41137 WP_003086123.1.41199 WP_003086123.1.41290 WP_003086123.1.41291 WP_003086123.1.41301 WP_003086123.1.41412 WP_003086123.1.41429 WP_003086123.1.41487 WP_003086123.1.41492 WP_003086123.1.41502 WP_003086123.1.4156 WP_003086123.1.41618 WP_003086123.1.41624 WP_003086123.1.41625 WP_003086123.1.41703 WP_003086123.1.41725 WP_003086123.1.41732 WP_003086123.1.41748 WP_003086123.1.41773 WP_003086123.1.41832 WP_003086123.1.41846 WP_003086123.1.41871 WP_003086123.1.41888 WP_003086123.1.4190 WP_003086123.1.41939 WP_003086123.1.4196 WP_003086123.1.42 WP_003086123.1.42019 WP_003086123.1.42041 WP_003086123.1.42047 WP_003086123.1.42146 WP_003086123.1.42259 WP_003086123.1.42294 WP_003086123.1.42316 WP_003086123.1.42381 WP_003086123.1.42388 WP_003086123.1.42411 WP_003086123.1.42423 WP_003086123.1.42499 WP_003086123.1.42508 WP_003086123.1.42634 WP_003086123.1.42643 WP_003086123.1.42690 WP_003086123.1.42696 WP_003086123.1.42723 WP_003086123.1.4273 WP_003086123.1.42754 WP_003086123.1.42757 WP_003086123.1.42778 WP_003086123.1.42789 WP_003086123.1.42854 WP_003086123.1.42870 WP_003086123.1.42917 WP_003086123.1.42946 WP_003086123.1.42952 WP_003086123.1.42972 WP_003086123.1.42973 WP_003086123.1.43022 WP_003086123.1.43024 WP_003086123.1.43049 WP_003086123.1.43106 WP_003086123.1.43107 WP_003086123.1.43212 WP_003086123.1.43245 WP_003086123.1.43286 WP_003086123.1.43293 WP_003086123.1.43315 WP_003086123.1.43326 WP_003086123.1.43330 WP_003086123.1.43356 WP_003086123.1.4348 WP_003086123.1.43593 WP_003086123.1.43603 WP_003086123.1.43662 WP_003086123.1.43667 WP_003086123.1.43673 WP_003086123.1.43696 WP_003086123.1.43729 WP_003086123.1.43756 WP_003086123.1.43783 WP_003086123.1.43802 WP_003086123.1.43811 WP_003086123.1.43826 WP_003086123.1.4397 WP_003086123.1.4398 WP_003086123.1.43998 WP_003086123.1.44046 WP_003086123.1.44094 WP_003086123.1.44213 WP_003086123.1.44260 WP_003086123.1.44269 WP_003086123.1.44373 WP_003086123.1.44434 WP_003086123.1.44486 WP_003086123.1.445 WP_003086123.1.44552 WP_003086123.1.44563 WP_003086123.1.44565 WP_003086123.1.44581 WP_003086123.1.44725 WP_003086123.1.44739 WP_003086123.1.44760 WP_003086123.1.44804 WP_003086123.1.44870 WP_003086123.1.4493 WP_003086123.1.44959 WP_003086123.1.45063 WP_003086123.1.45090 WP_003086123.1.45146 WP_003086123.1.45199 WP_003086123.1.45202 WP_003086123.1.4522 WP_003086123.1.45228 WP_003086123.1.45298 WP_003086123.1.45306 WP_003086123.1.45312 WP_003086123.1.4532 WP_003086123.1.45328 WP_003086123.1.45353 WP_003086123.1.45358 WP_003086123.1.45464 WP_003086123.1.45478 WP_003086123.1.45485 WP_003086123.1.45604 WP_003086123.1.45611 WP_003086123.1.45635 WP_003086123.1.45636 WP_003086123.1.45678 WP_003086123.1.45700 WP_003086123.1.45711 WP_003086123.1.45818 WP_003086123.1.45837 WP_003086123.1.45934 WP_003086123.1.45946 WP_003086123.1.45961 WP_003086123.1.46010 WP_003086123.1.46032 WP_003086123.1.46093 WP_003086123.1.461 WP_003086123.1.46152 WP_003086123.1.46200 WP_003086123.1.46306 WP_003086123.1.4640 WP_003086123.1.46436 WP_003086123.1.46502 WP_003086123.1.46623 WP_003086123.1.46633 WP_003086123.1.46755 WP_003086123.1.46787 WP_003086123.1.46826 WP_003086123.1.46846 WP_003086123.1.46866 WP_003086123.1.46885 WP_003086123.1.46926 WP_003086123.1.46935 WP_003086123.1.4699 WP_003086123.1.47101 WP_003086123.1.47150 WP_003086123.1.47155 WP_003086123.1.47158 WP_003086123.1.47251 WP_003086123.1.4726 WP_003086123.1.47296 WP_003086123.1.47312 WP_003086123.1.47314 WP_003086123.1.47480 WP_003086123.1.47527 WP_003086123.1.47551 WP_003086123.1.47598 WP_003086123.1.47645 WP_003086123.1.47774 WP_003086123.1.47930 WP_003086123.1.47934 WP_003086123.1.47970 WP_003086123.1.48001 WP_003086123.1.48024 WP_003086123.1.48086 WP_003086123.1.48094 WP_003086123.1.48141 WP_003086123.1.48172 WP_003086123.1.48178 WP_003086123.1.48321 WP_003086123.1.48334 WP_003086123.1.4836 WP_003086123.1.48378 WP_003086123.1.48382 WP_003086123.1.48413 WP_003086123.1.48472 WP_003086123.1.48474 WP_003086123.1.48487 WP_003086123.1.48545 WP_003086123.1.48576 WP_003086123.1.48579 WP_003086123.1.48810 WP_003086123.1.48820 WP_003086123.1.48840 WP_003086123.1.48842 WP_003086123.1.48851 WP_003086123.1.48870 WP_003086123.1.49108 WP_003086123.1.4913 WP_003086123.1.49135 WP_003086123.1.49184 WP_003086123.1.49244 WP_003086123.1.49265 WP_003086123.1.49266 WP_003086123.1.49277 WP_003086123.1.49286 WP_003086123.1.49293 WP_003086123.1.49360 WP_003086123.1.49416 WP_003086123.1.49500 WP_003086123.1.49557 WP_003086123.1.49688 WP_003086123.1.49798 WP_003086123.1.49806 WP_003086123.1.49833 WP_003086123.1.49842 WP_003086123.1.49922 WP_003086123.1.49948 WP_003086123.1.49976 WP_003086123.1.49988 WP_003086123.1.49998 WP_003086123.1.50176 WP_003086123.1.50180 WP_003086123.1.50222 WP_003086123.1.50232 WP_003086123.1.50242 WP_003086123.1.5043 WP_003086123.1.50450 WP_003086123.1.50459 WP_003086123.1.50567 WP_003086123.1.50653 WP_003086123.1.50665 WP_003086123.1.50668 WP_003086123.1.50682 WP_003086123.1.50691 WP_003086123.1.50734 WP_003086123.1.50783 WP_003086123.1.50814 WP_003086123.1.50922 WP_003086123.1.50967 WP_003086123.1.50989 WP_003086123.1.51019 WP_003086123.1.51035 WP_003086123.1.51136 WP_003086123.1.51141 WP_003086123.1.51173 WP_003086123.1.51183 WP_003086123.1.51267 WP_003086123.1.51273 WP_003086123.1.5132 WP_003086123.1.51457 WP_003086123.1.51472 WP_003086123.1.51501 WP_003086123.1.51538 WP_003086123.1.51549 WP_003086123.1.51585 WP_003086123.1.51682 WP_003086123.1.51727 WP_003086123.1.51807 WP_003086123.1.51847 WP_003086123.1.51889 WP_003086123.1.51928 WP_003086123.1.51937 WP_003086123.1.51943 WP_003086123.1.51957 WP_003086123.1.51976 WP_003086123.1.52043 WP_003086123.1.52152 WP_003086123.1.52212 WP_003086123.1.52220 WP_003086123.1.52244 WP_003086123.1.5226 WP_003086123.1.52326 WP_003086123.1.52334 WP_003086123.1.5235 WP_003086123.1.52355 WP_003086123.1.52372 WP_003086123.1.52403 WP_003086123.1.52409 WP_003086123.1.52449 WP_003086123.1.52500 WP_003086123.1.52537 WP_003086123.1.5258 WP_003086123.1.52583 WP_003086123.1.52591 WP_003086123.1.5260 WP_003086123.1.52690 WP_003086123.1.52697 WP_003086123.1.52700 WP_003086123.1.52784 WP_003086123.1.52790 WP_003086123.1.52810 WP_003086123.1.52850 WP_003086123.1.5289 WP_003086123.1.52939 WP_003086123.1.5294 WP_003086123.1.53038 WP_003086123.1.53072 WP_003086123.1.53169 WP_003086123.1.53267 WP_003086123.1.53287 WP_003086123.1.53351 WP_003086123.1.53371 WP_003086123.1.53414 WP_003086123.1.53427 WP_003086123.1.53486 WP_003086123.1.53528 WP_003086123.1.53530 WP_003086123.1.53586 WP_003086123.1.53663 WP_003086123.1.53678 WP_003086123.1.53719 WP_003086123.1.53726 WP_003086123.1.53826 WP_003086123.1.5388 WP_003086123.1.53932 WP_003086123.1.53946 WP_003086123.1.53948 WP_003086123.1.53951 WP_003086123.1.5399 WP_003086123.1.54003 WP_003086123.1.54076 WP_003086123.1.54078 WP_003086123.1.54090 WP_003086123.1.54133 WP_003086123.1.54140 WP_003086123.1.54146 WP_003086123.1.54248 WP_003086123.1.5427 WP_003086123.1.54293 WP_003086123.1.54354 WP_003086123.1.54462 WP_003086123.1.54497 WP_003086123.1.54571 WP_003086123.1.54742 WP_003086123.1.54809 WP_003086123.1.54974 WP_003086123.1.55 WP_003086123.1.55089 WP_003086123.1.55169 WP_003086123.1.55318 WP_003086123.1.55347 WP_003086123.1.55387 WP_003086123.1.55400 WP_003086123.1.55445 WP_003086123.1.55478 WP_003086123.1.55543 WP_003086123.1.55729 WP_003086123.1.55813 WP_003086123.1.55976 WP_003086123.1.56013 WP_003086123.1.56145 WP_003086123.1.56171 WP_003086123.1.56187 WP_003086123.1.56188 WP_003086123.1.56196 WP_003086123.1.56228 WP_003086123.1.56229 WP_003086123.1.56315 WP_003086123.1.56348 WP_003086123.1.56442 WP_003086123.1.56452 WP_003086123.1.56465 WP_003086123.1.56474 WP_003086123.1.56475 WP_003086123.1.56623 WP_003086123.1.56626 WP_003086123.1.56632 WP_003086123.1.56745 WP_003086123.1.56768 WP_003086123.1.56797 WP_003086123.1.56808 WP_003086123.1.56819 WP_003086123.1.56837 WP_003086123.1.56864 WP_003086123.1.56973 WP_003086123.1.57005 WP_003086123.1.57020 WP_003086123.1.57065 WP_003086123.1.57113 WP_003086123.1.57131 WP_003086123.1.57140 WP_003086123.1.57276 WP_003086123.1.5731 WP_003086123.1.57339 WP_003086123.1.57369 WP_003086123.1.57417 WP_003086123.1.57460 WP_003086123.1.57480 WP_003086123.1.57566 WP_003086123.1.57792 WP_003086123.1.57839 WP_003086123.1.57841 WP_003086123.1.57921 WP_003086123.1.57966 WP_003086123.1.58019 WP_003086123.1.58056 WP_003086123.1.58155 WP_003086123.1.58162 WP_003086123.1.58183 WP_003086123.1.58193 WP_003086123.1.58200 WP_003086123.1.58228 WP_003086123.1.58294 WP_003086123.1.58360 WP_003086123.1.58417 WP_003086123.1.58436 WP_003086123.1.58482 WP_003086123.1.5850 WP_003086123.1.58510 WP_003086123.1.58527 WP_003086123.1.5856 WP_003086123.1.58581 WP_003086123.1.58689 WP_003086123.1.5869 WP_003086123.1.58785 WP_003086123.1.58800 WP_003086123.1.58838 WP_003086123.1.58845 WP_003086123.1.5889 WP_003086123.1.58944 WP_003086123.1.58952 WP_003086123.1.5897 WP_003086123.1.59013 WP_003086123.1.59076 WP_003086123.1.59099 WP_003086123.1.59156 WP_003086123.1.59158 WP_003086123.1.59176 WP_003086123.1.59212 WP_003086123.1.59246 WP_003086123.1.59249 WP_003086123.1.59250 WP_003086123.1.59288 WP_003086123.1.59339 WP_003086123.1.5937 WP_003086123.1.59376 WP_003086123.1.59385 WP_003086123.1.594 WP_003086123.1.59469 WP_003086123.1.59563 WP_003086123.1.59688 WP_003086123.1.59724 WP_003086123.1.59759 WP_003086123.1.59797 WP_003086123.1.59831 WP_003086123.1.59870 WP_003086123.1.59943 WP_003086123.1.60051 WP_003086123.1.60062 WP_003086123.1.60079 WP_003086123.1.60082 WP_003086123.1.60084 WP_003086123.1.60085 WP_003086123.1.60206 WP_003086123.1.60261 WP_003086123.1.60364 WP_003086123.1.60396 WP_003086123.1.60472 WP_003086123.1.60509 WP_003086123.1.60600 WP_003086123.1.60602 WP_003086123.1.60603 WP_003086123.1.60639 WP_003086123.1.60679 WP_003086123.1.60686 WP_003086123.1.60850 WP_003086123.1.60910 WP_003086123.1.60916 WP_003086123.1.60970 WP_003086123.1.61122 WP_003086123.1.61130 WP_003086123.1.61191 WP_003086123.1.61209 WP_003086123.1.61222 WP_003086123.1.61269 WP_003086123.1.61288 WP_003086123.1.61294 WP_003086123.1.61299 WP_003086123.1.6130 WP_003086123.1.61366 WP_003086123.1.61431 WP_003086123.1.61493 WP_003086123.1.61549 WP_003086123.1.61589 WP_003086123.1.61598 WP_003086123.1.616 WP_003086123.1.61696 WP_003086123.1.6173 WP_003086123.1.61943 WP_003086123.1.62010 WP_003086123.1.62035 WP_003086123.1.62180 WP_003086123.1.62186 WP_003086123.1.62357 WP_003086123.1.62396 WP_003086123.1.62410 WP_003086123.1.62483 WP_003086123.1.62516 WP_003086123.1.62534 WP_003086123.1.626 WP_003086123.1.62604 WP_003086123.1.62635 WP_003086123.1.62701 WP_003086123.1.62703 WP_003086123.1.62704 WP_003086123.1.62708 WP_003086123.1.62716 WP_003086123.1.62768 WP_003086123.1.62772 WP_003086123.1.6280 WP_003086123.1.6283 WP_003086123.1.62834 WP_003086123.1.62838 WP_003086123.1.62873 WP_003086123.1.62917 WP_003086123.1.62961 WP_003086123.1.62977 WP_003086123.1.63041 WP_003086123.1.63057 WP_003086123.1.63124 WP_003086123.1.63193 WP_003086123.1.63196 WP_003086123.1.63338 WP_003086123.1.63369 WP_003086123.1.63401 WP_003086123.1.63591 WP_003086123.1.63597 WP_003086123.1.63634 WP_003086123.1.63659 WP_003086123.1.63739 WP_003086123.1.63784 WP_003086123.1.63929 WP_003086123.1.63941 WP_003086123.1.63995 WP_003086123.1.64155 WP_003086123.1.64198 WP_003086123.1.64212 WP_003086123.1.64309 WP_003086123.1.64329 WP_003086123.1.64340 WP_003086123.1.64433 WP_003086123.1.6450 WP_003086123.1.64544 WP_003086123.1.64591 WP_003086123.1.64603 WP_003086123.1.64605 WP_003086123.1.64611 WP_003086123.1.64726 WP_003086123.1.64748 WP_003086123.1.64799 WP_003086123.1.64807 WP_003086123.1.64854 WP_003086123.1.64862 WP_003086123.1.64880 WP_003086123.1.64885 WP_003086123.1.64886 WP_003086123.1.64983 WP_003086123.1.64984 WP_003086123.1.65009 WP_003086123.1.65066 WP_003086123.1.65092 WP_003086123.1.65095 WP_003086123.1.65099 WP_003086123.1.65145 WP_003086123.1.65196 WP_003086123.1.65197 WP_003086123.1.65227 WP_003086123.1.65237 WP_003086123.1.65247 WP_003086123.1.65285 WP_003086123.1.65312 WP_003086123.1.65316 WP_003086123.1.65334 WP_003086123.1.65335 WP_003086123.1.65337 WP_003086123.1.65457 WP_003086123.1.65478 WP_003086123.1.65549 WP_003086123.1.65588 WP_003086123.1.65632 WP_003086123.1.65642 WP_003086123.1.65679 WP_003086123.1.65740 WP_003086123.1.65779 WP_003086123.1.65819 WP_003086123.1.65867 WP_003086123.1.6589 WP_003086123.1.65926 WP_003086123.1.66062 WP_003086123.1.66088 WP_003086123.1.66155 WP_003086123.1.66165 WP_003086123.1.6627 WP_003086123.1.66277 WP_003086123.1.6629 WP_003086123.1.66345 WP_003086123.1.66348 WP_003086123.1.66364 WP_003086123.1.66371 WP_003086123.1.66526 WP_003086123.1.66563 WP_003086123.1.66634 WP_003086123.1.66693 WP_003086123.1.66721 WP_003086123.1.66929 WP_003086123.1.66931 WP_003086123.1.66945 WP_003086123.1.66950 WP_003086123.1.66982 WP_003086123.1.67010 WP_003086123.1.67124 WP_003086123.1.67188 WP_003086123.1.67205 WP_003086123.1.67261 WP_003086123.1.6734 WP_003086123.1.67370 WP_003086123.1.67388 WP_003086123.1.67472 WP_003086123.1.67506 WP_003086123.1.67526 WP_003086123.1.67531 WP_003086123.1.67545 WP_003086123.1.6768 WP_003086123.1.67686 WP_003086123.1.67755 WP_003086123.1.67830 WP_003086123.1.67874 WP_003086123.1.67875 WP_003086123.1.67899 WP_003086123.1.67903 WP_003086123.1.67937 WP_003086123.1.67948 WP_003086123.1.6796 WP_003086123.1.68000 WP_003086123.1.6808 WP_003086123.1.68158 WP_003086123.1.68162 WP_003086123.1.68172 WP_003086123.1.68183 WP_003086123.1.68194 WP_003086123.1.68252 WP_003086123.1.68317 WP_003086123.1.68446 WP_003086123.1.68448 WP_003086123.1.68472 WP_003086123.1.68499 WP_003086123.1.6850 WP_003086123.1.68541 WP_003086123.1.68561 WP_003086123.1.68568 WP_003086123.1.68638 WP_003086123.1.68756 WP_003086123.1.68781 WP_003086123.1.68790 WP_003086123.1.68800 WP_003086123.1.68802 WP_003086123.1.68850 WP_003086123.1.68857 WP_003086123.1.68862 WP_003086123.1.68910 WP_003086123.1.68938 WP_003086123.1.68979 WP_003086123.1.6911 WP_003086123.1.69159 WP_003086123.1.69209 WP_003086123.1.69260 WP_003086123.1.6928 WP_003086123.1.6931 WP_003086123.1.6937 WP_003086123.1.69411 WP_003086123.1.69534 WP_003086123.1.69556 WP_003086123.1.69599 WP_003086123.1.69702 WP_003086123.1.69791 WP_003086123.1.69819 WP_003086123.1.69834 WP_003086123.1.69907 WP_003086123.1.69993 WP_003086123.1.70092 WP_003086123.1.70098 WP_003086123.1.70138 WP_003086123.1.70168 WP_003086123.1.70194 WP_003086123.1.70216 WP_003086123.1.70229 WP_003086123.1.70331 WP_003086123.1.70460 WP_003086123.1.70470 WP_003086123.1.70537 WP_003086123.1.70561 WP_003086123.1.70583 WP_003086123.1.70648 WP_003086123.1.70650 WP_003086123.1.70670 WP_003086123.1.70677 WP_003086123.1.70693 WP_003086123.1.7077 WP_003086123.1.70778 WP_003086123.1.70831 WP_003086123.1.70991 WP_003086123.1.71038 WP_003086123.1.71141 WP_003086123.1.71203 WP_003086123.1.71234 WP_003086123.1.71249 WP_003086123.1.71254 WP_003086123.1.7128 WP_003086123.1.71290 WP_003086123.1.71346 WP_003086123.1.71385 WP_003086123.1.71412 WP_003086123.1.71570 WP_003086123.1.71610 WP_003086123.1.7163 WP_003086123.1.71642 WP_003086123.1.71666 WP_003086123.1.71738 WP_003086123.1.71799 WP_003086123.1.71806 WP_003086123.1.71822 WP_003086123.1.71862 WP_003086123.1.71866 WP_003086123.1.71891 WP_003086123.1.71934 WP_003086123.1.72149 WP_003086123.1.72167 WP_003086123.1.72181 WP_003086123.1.72183 WP_003086123.1.7219 WP_003086123.1.72287 WP_003086123.1.72323 WP_003086123.1.72331 WP_003086123.1.72346 WP_003086123.1.72378 WP_003086123.1.72447 WP_003086123.1.72458 WP_003086123.1.72477 WP_003086123.1.72541 WP_003086123.1.72562 WP_003086123.1.72570 WP_003086123.1.72653 WP_003086123.1.72662 WP_003086123.1.72669 WP_003086123.1.72727 WP_003086123.1.7276 WP_003086123.1.72768 WP_003086123.1.72772 WP_003086123.1.72782 WP_003086123.1.72845 WP_003086123.1.72920 WP_003086123.1.73035 WP_003086123.1.73048 WP_003086123.1.7308 WP_003086123.1.73135 WP_003086123.1.73149 WP_003086123.1.73172 WP_003086123.1.73192 WP_003086123.1.7327 WP_003086123.1.7329 WP_003086123.1.733 WP_003086123.1.73455 WP_003086123.1.73490 WP_003086123.1.73523 WP_003086123.1.73541 WP_003086123.1.73601 WP_003086123.1.73719 WP_003086123.1.73728 WP_003086123.1.7377 WP_003086123.1.73791 WP_003086123.1.7382 WP_003086123.1.73860 WP_003086123.1.73889 WP_003086123.1.73911 WP_003086123.1.73941 WP_003086123.1.74000 WP_003086123.1.74072 WP_003086123.1.74074 WP_003086123.1.7408 WP_003086123.1.74106 WP_003086123.1.74167 WP_003086123.1.74175 WP_003086123.1.74180 WP_003086123.1.74182 WP_003086123.1.74219 WP_003086123.1.74264 WP_003086123.1.74268 WP_003086123.1.74281 WP_003086123.1.74287 WP_003086123.1.74326 WP_003086123.1.7445 WP_003086123.1.74458 WP_003086123.1.74473 WP_003086123.1.74475 WP_003086123.1.7448 WP_003086123.1.74518 WP_003086123.1.7456 WP_003086123.1.74568 WP_003086123.1.74604 WP_003086123.1.74629 WP_003086123.1.74637 WP_003086123.1.74685 WP_003086123.1.74772 WP_003086123.1.748 WP_003086123.1.74878 WP_003086123.1.74941 WP_003086123.1.74958 WP_003086123.1.7501 WP_003086123.1.75041 WP_003086123.1.75119 WP_003086123.1.75204 WP_003086123.1.75277 WP_003086123.1.75303 WP_003086123.1.75389 WP_003086123.1.75431 WP_003086123.1.7547 WP_003086123.1.75549 WP_003086123.1.75573 WP_003086123.1.75580 WP_003086123.1.75599 WP_003086123.1.75603 WP_003086123.1.75631 WP_003086123.1.7568 WP_003086123.1.75756 WP_003086123.1.75771 WP_003086123.1.75792 WP_003086123.1.75825 WP_003086123.1.75826 WP_003086123.1.75860 WP_003086123.1.75935 WP_003086123.1.75938 WP_003086123.1.75947 WP_003086123.1.7595 WP_003086123.1.76077 WP_003086123.1.76141 WP_003086123.1.76145 WP_003086123.1.76322 WP_003086123.1.76355 WP_003086123.1.76383 WP_003086123.1.76399 WP_003086123.1.76441 WP_003086123.1.76467 WP_003086123.1.76484 WP_003086123.1.76543 WP_003086123.1.76600 WP_003086123.1.7666 WP_003086123.1.76716 WP_003086123.1.76775 WP_003086123.1.76791 WP_003086123.1.76861 WP_003086123.1.76922 WP_003086123.1.76985 WP_003086123.1.77235 WP_003086123.1.77286 WP_003086123.1.77317 WP_003086123.1.77442 WP_003086123.1.77476 WP_003086123.1.77490 WP_003086123.1.77566 WP_003086123.1.77574 WP_003086123.1.77587 WP_003086123.1.77686 WP_003086123.1.77750 WP_003086123.1.77769 WP_003086123.1.7779 WP_003086123.1.77819 WP_003086123.1.77834 WP_003086123.1.77913 WP_003086123.1.78104 WP_003086123.1.78112 WP_003086123.1.78118 WP_003086123.1.78134 WP_003086123.1.78148 WP_003086123.1.78158 WP_003086123.1.78280 WP_003086123.1.78288 WP_003086123.1.78380 WP_003086123.1.7840 WP_003086123.1.78409 WP_003086123.1.78425 WP_003086123.1.78430 WP_003086123.1.78437 WP_003086123.1.78570 WP_003086123.1.78599 WP_003086123.1.78623 WP_003086123.1.78669 WP_003086123.1.78693 WP_003086123.1.78795 WP_003086123.1.788 WP_003086123.1.78810 WP_003086123.1.78926 WP_003086123.1.78954 WP_003086123.1.78986 WP_003086123.1.7899 WP_003086123.1.79003 WP_003086123.1.79007 WP_003086123.1.79053 WP_003086123.1.79060 WP_003086123.1.79177 WP_003086123.1.79193 WP_003086123.1.79256 WP_003086123.1.79279 WP_003086123.1.79286 WP_003086123.1.79311 WP_003086123.1.79357 WP_003086123.1.79421 WP_003086123.1.79429 WP_003086123.1.79431 WP_003086123.1.7945 WP_003086123.1.79463 WP_003086123.1.79507 WP_003086123.1.7953 WP_003086123.1.79544 WP_003086123.1.79569 WP_003086123.1.79601 WP_003086123.1.79631 WP_003086123.1.79699 WP_003086123.1.79754 WP_003086123.1.79788 WP_003086123.1.79862 WP_003086123.1.79883 WP_003086123.1.799 WP_003086123.1.79902 WP_003086123.1.79908 WP_003086123.1.79986 WP_003086123.1.8 WP_003086123.1.80033 WP_003086123.1.80068 WP_003086123.1.80087 WP_003086123.1.80102 WP_003086123.1.8013 WP_003086123.1.80174 WP_003086123.1.80258 WP_003086123.1.8028 WP_003086123.1.80306 WP_003086123.1.8038 WP_003086123.1.80410 WP_003086123.1.80411 WP_003086123.1.80454 WP_003086123.1.80481 WP_003086123.1.8051 WP_003086123.1.80535 WP_003086123.1.80572 WP_003086123.1.80627 WP_003086123.1.80632 WP_003086123.1.8064 WP_003086123.1.80644 WP_003086123.1.80645 WP_003086123.1.80683 WP_003086123.1.80715 WP_003086123.1.80720 WP_003086123.1.80785 WP_003086123.1.80846 WP_003086123.1.80880 WP_003086123.1.80892 WP_003086123.1.80910 WP_003086123.1.80926 WP_003086123.1.80929 WP_003086123.1.80938 WP_003086123.1.80969 WP_003086123.1.81081 WP_003086123.1.81082 WP_003086123.1.81206 WP_003086123.1.81237 WP_003086123.1.81331 WP_003086123.1.81349 WP_003086123.1.81368 WP_003086123.1.81380 WP_003086123.1.8141 WP_003086123.1.81426 WP_003086123.1.81470 WP_003086123.1.81487 WP_003086123.1.81581 WP_003086123.1.81591 WP_003086123.1.81622 WP_003086123.1.81708 WP_003086123.1.81728 WP_003086123.1.81742 WP_003086123.1.81748 WP_003086123.1.81771 WP_003086123.1.81784 WP_003086123.1.81802 WP_003086123.1.81816 WP_003086123.1.81834 WP_003086123.1.81844 WP_003086123.1.81856 WP_003086123.1.81874 WP_003086123.1.81927 WP_003086123.1.81950 WP_003086123.1.81957 WP_003086123.1.81960 WP_003086123.1.81986 WP_003086123.1.82117 WP_003086123.1.82127 WP_003086123.1.82178 WP_003086123.1.82260 WP_003086123.1.8227 WP_003086123.1.82310 WP_003086123.1.82312 WP_003086123.1.82328 WP_003086123.1.82334 WP_003086123.1.8238 WP_003086123.1.82442 WP_003086123.1.82487 WP_003086123.1.82580 WP_003086123.1.82604 WP_003086123.1.82606 WP_003086123.1.82620 WP_003086123.1.82643 WP_003086123.1.82686 WP_003086123.1.82710 WP_003086123.1.82798 WP_003086123.1.82810 WP_003086123.1.82864 WP_003086123.1.82882 WP_003086123.1.82887 WP_003086123.1.82936 WP_003086123.1.83025 WP_003086123.1.83131 WP_003086123.1.83184 WP_003086123.1.83213 WP_003086123.1.83251 WP_003086123.1.83267 WP_003086123.1.83296 WP_003086123.1.83317 WP_003086123.1.83374 WP_003086123.1.83394 WP_003086123.1.83440 WP_003086123.1.83460 WP_003086123.1.83463 WP_003086123.1.835 WP_003086123.1.83503 WP_003086123.1.8351 WP_003086123.1.8353 WP_003086123.1.83534 WP_003086123.1.83540 WP_003086123.1.8357 WP_003086123.1.83637 WP_003086123.1.83673 WP_003086123.1.83698 WP_003086123.1.83715 WP_003086123.1.83871 WP_003086123.1.83937 WP_003086123.1.83946 WP_003086123.1.84003 WP_003086123.1.84008 WP_003086123.1.84138 WP_003086123.1.84162 WP_003086123.1.84174 WP_003086123.1.84177 WP_003086123.1.84178 WP_003086123.1.84190 WP_003086123.1.84203 WP_003086123.1.84271 WP_003086123.1.84297 WP_003086123.1.8437 WP_003086123.1.84374 WP_003086123.1.84398 WP_003086123.1.84404 WP_003086123.1.84439 WP_003086123.1.84471 WP_003086123.1.84526 WP_003086123.1.8453 WP_003086123.1.84538 WP_003086123.1.84558 WP_003086123.1.84589 WP_003086123.1.84674 WP_003086123.1.84684 WP_003086123.1.84702 WP_003086123.1.84715 WP_003086123.1.84754 WP_003086123.1.84792 WP_003086123.1.84825 WP_003086123.1.8484 WP_003086123.1.84865 WP_003086123.1.84937 WP_003086123.1.85018 WP_003086123.1.85028 WP_003086123.1.85150 WP_003086123.1.85220 WP_003086123.1.85290 WP_003086123.1.85298 WP_003086123.1.85303 WP_003086123.1.85311 WP_003086123.1.85318 WP_003086123.1.85357 WP_003086123.1.85446 WP_003086123.1.85453 WP_003086123.1.85633 WP_003086123.1.85638 WP_003086123.1.85788 WP_003086123.1.85897 WP_003086123.1.85910 WP_003086123.1.85920 WP_003086123.1.85978 WP_003086123.1.86002 WP_003086123.1.86047 WP_003086123.1.86055 WP_003086123.1.86058 WP_003086123.1.861 WP_003086123.1.86125 WP_003086123.1.86182 WP_003086123.1.86243 WP_003086123.1.86278 WP_003086123.1.86287 WP_003086123.1.86293 WP_003086123.1.86386 WP_003086123.1.86432 WP_003086123.1.8645 WP_003086123.1.865 WP_003086123.1.86506 WP_003086123.1.86545 WP_003086123.1.86552 WP_003086123.1.86554 WP_003086123.1.86595 WP_003086123.1.86652 WP_003086123.1.86665 WP_003086123.1.86708 WP_003086123.1.86733 WP_003086123.1.86774 WP_003086123.1.86780 WP_003086123.1.86785 WP_003086123.1.86796 WP_003086123.1.86813 WP_003086123.1.86822 WP_003086123.1.8693 WP_003086123.1.86947 WP_003086123.1.86970 WP_003086123.1.86985 WP_003086123.1.87104 WP_003086123.1.87163 WP_003086123.1.8718 WP_003086123.1.87182 WP_003086123.1.87183 WP_003086123.1.8727 WP_003086123.1.87390 WP_003086123.1.87435 WP_003086123.1.87463 WP_003086123.1.8749 WP_003086123.1.87530 WP_003086123.1.87547 WP_003086123.1.87648 WP_003086123.1.87763 WP_003086123.1.8785 WP_003086123.1.87877 WP_003086123.1.87888 WP_003086123.1.87970 WP_003086123.1.87975 WP_003086123.1.87987 WP_003086123.1.88004 WP_003086123.1.88152 WP_003086123.1.88308 WP_003086123.1.88330 WP_003086123.1.88360 WP_003086123.1.88388 WP_003086123.1.88415 WP_003086123.1.88517 WP_003086123.1.8852 WP_003086123.1.88540 WP_003086123.1.88550 WP_003086123.1.88578 WP_003086123.1.88605 WP_003086123.1.88659 WP_003086123.1.88679 WP_003086123.1.88680 WP_003086123.1.88714 WP_003086123.1.88750 WP_003086123.1.88796 WP_003086123.1.889 WP_003086123.1.88949 WP_003086123.1.88969 WP_003086123.1.89083 WP_003086123.1.89098 WP_003086123.1.8911 WP_003086123.1.89234 WP_003086123.1.89266 WP_003086123.1.89276 WP_003086123.1.89409 WP_003086123.1.89434 WP_003086123.1.89480 WP_003086123.1.8949 WP_003086123.1.89491 WP_003086123.1.89523 WP_003086123.1.89577 WP_003086123.1.89610 WP_003086123.1.89638 WP_003086123.1.89662 WP_003086123.1.89669 WP_003086123.1.89736 WP_003086123.1.8976 WP_003086123.1.89776 WP_003086123.1.89805 WP_003086123.1.89866 WP_003086123.1.89867 WP_003086123.1.89868 WP_003086123.1.89871 WP_003086123.1.89886 WP_003086123.1.89992 WP_003086123.1.90024 WP_003086123.1.90032 WP_003086123.1.90056 WP_003086123.1.90110 WP_003086123.1.90141 WP_003086123.1.90150 WP_003086123.1.90189 WP_003086123.1.90224 WP_003086123.1.90225 WP_003086123.1.90242 WP_003086123.1.90268 WP_003086123.1.90272 WP_003086123.1.90306 WP_003086123.1.90412 WP_003086123.1.9056 WP_003086123.1.90569 WP_003086123.1.90655 WP_003086123.1.90770 WP_003086123.1.90940 WP_003086123.1.90999 WP_003086123.1.91012 WP_003086123.1.91093 WP_003086123.1.91161 WP_003086123.1.9120 WP_003086123.1.91204 WP_003086123.1.91236 WP_003086123.1.91281 WP_003086123.1.91307 WP_003086123.1.91336 WP_003086123.1.91392 WP_003086123.1.91416 WP_003086123.1.9143 WP_003086123.1.91431 WP_003086123.1.91438 WP_003086123.1.91467 WP_003086123.1.91527 WP_003086123.1.91563 WP_003086123.1.91585 WP_003086123.1.91796 WP_003086123.1.91803 WP_003086123.1.9182 WP_003086123.1.91838 WP_003086123.1.91846 WP_003086123.1.91860 WP_003086123.1.91862 WP_003086123.1.91882 WP_003086123.1.9191 WP_003086123.1.91943 WP_003086123.1.92043 WP_003086123.1.92175 WP_003086123.1.9219 WP_003086123.1.92314 WP_003086123.1.92321 WP_003086123.1.92357 WP_003086123.1.92454 WP_003086123.1.92573 WP_003086123.1.92585 WP_003086123.1.92587 WP_003086123.1.92589 WP_003086123.1.92594 WP_003086123.1.92624 WP_003086123.1.92630 WP_003086123.1.92642 WP_003086123.1.9272 WP_003086123.1.92759 WP_003086123.1.92769 WP_003086123.1.92839 WP_003086123.1.92847 WP_003086123.1.92894 WP_003086123.1.92924 WP_003086123.1.92930 WP_003086123.1.93001 WP_003086123.1.93090 WP_003086123.1.93122 WP_003086123.1.93130 WP_003086123.1.93144 WP_003086123.1.93148 WP_003086123.1.93196 WP_003086123.1.93250 WP_003086123.1.93264 WP_003086123.1.9328 WP_003086123.1.9349 WP_003086123.1.93493 WP_003086123.1.93498 WP_003086123.1.93520 WP_003086123.1.93547 WP_003086123.1.93562 WP_003086123.1.93568 WP_003086123.1.93797 WP_003086123.1.93848 WP_003086123.1.93889 WP_003086123.1.93897 WP_003086123.1.94004 WP_003086123.1.94031 WP_003086123.1.94065 WP_003086123.1.94078 WP_003086123.1.94136 WP_003086123.1.94174 WP_003086123.1.94211 WP_003086123.1.94218 WP_003086123.1.94230 WP_003086123.1.94243 WP_003086123.1.94285 WP_003086123.1.94288 WP_003086123.1.94333 WP_003086123.1.94349 WP_003086123.1.94385 WP_003086123.1.94422 WP_003086123.1.94434 WP_003086123.1.9444 WP_003086123.1.94450 WP_003086123.1.94682 WP_003086123.1.94732 WP_003086123.1.94742 WP_003086123.1.94814 WP_003086123.1.94818 WP_003086123.1.94856 WP_003086123.1.94874 WP_003086123.1.94881 WP_003086123.1.94896 WP_003086123.1.94897 WP_003086123.1.94943 WP_003086123.1.95018 WP_003086123.1.95025 WP_003086123.1.95027 WP_003086123.1.95117 WP_003086123.1.95132 WP_003086123.1.95187 WP_003086123.1.95207 WP_003086123.1.95217 WP_003086123.1.95305 WP_003086123.1.95324 WP_003086123.1.95354 WP_003086123.1.95359 WP_003086123.1.95460 WP_003086123.1.95488 WP_003086123.1.95525 WP_003086123.1.95536 WP_003086123.1.95638 WP_003086123.1.95668 WP_003086123.1.95745 WP_003086123.1.95751 WP_003086123.1.95782 WP_003086123.1.95787 WP_003086123.1.95802 WP_003086123.1.95820 WP_003086123.1.95825 WP_003086123.1.95959 WP_003086123.1.9599 WP_003086123.1.95994 WP_003086123.1.95999 WP_003086123.1.9604 WP_003086123.1.96041 WP_003086123.1.96058 WP_003086123.1.961 WP_003086123.1.96134 WP_003086123.1.96193 WP_003086123.1.96243 WP_003086123.1.96267 WP_003086123.1.96357 WP_003086123.1.96384 WP_003086123.1.96434 WP_003086123.1.96452 WP_003086123.1.96506 WP_003086123.1.96667 WP_003086123.1.96702 WP_003086123.1.96714 WP_003086123.1.96863 WP_003086123.1.96880 WP_003086123.1.96967 WP_003086123.1.9706 WP_003086123.1.97118 WP_003086123.1.97126 WP_003086123.1.97204 WP_003086123.1.97213 WP_003086123.1.9722 WP_003086123.1.97271 WP_003086123.1.97272 WP_003086123.1.97377 WP_003086123.1.97461 WP_003086123.1.97474 WP_003086123.1.97499 WP_003086123.1.97503 WP_003086123.1.97521 WP_003086123.1.97583 WP_003086123.1.97614 WP_003086123.1.977 WP_003086123.1.97784 WP_003086123.1.97826 WP_003086123.1.97877 WP_003086123.1.97968 WP_003086123.1.98111 WP_003086123.1.98260 WP_003086123.1.98276 WP_003086123.1.98308 WP_003086123.1.98410 WP_003086123.1.98414 WP_003086123.1.98433 WP_003086123.1.9845 WP_003086123.1.985 WP_003086123.1.98515 WP_003086123.1.98522 WP_003086123.1.98573 WP_003086123.1.98600 WP_003086123.1.98610 WP_003086123.1.98672 WP_003086123.1.98678 WP_003086123.1.98788 WP_003086123.1.98814 WP_003086123.1.9885 WP_003086123.1.98873 WP_003086123.1.98907 WP_003086123.1.98926 WP_003086123.1.98958 WP_003086123.1.98960 WP_003086123.1.98963 WP_003086123.1.99065 WP_003086123.1.99068 WP_003086123.1.99103 WP_003086123.1.99214 WP_003086123.1.99293 WP_003086123.1.99353 WP_003086123.1.99378 WP_003086123.1.99386 WP_003086123.1.99389 WP_003086123.1.99443 WP_003086123.1.99461 WP_003086123.1.9951 WP_003086123.1.99516 WP_003086123.1.99647 WP_003086123.1.99654 WP_003086123.1.99662 WP_003086123.1.99746 WP_003086123.1.99757 WP_003086123.1.99772 WP_003086123.1.99795 WP_003086123.1.99835 WP_003086123.1.9989 WP_003086123.1.99930 gi|386064716|ref|YP_005980020.1| gi|386060131|ref|YP_005976653.1| gi|568311286|ref|YP_008983555.1| gi|478480290|ref|YP_007710941.1| gi|15596164|ref|NP_249658.1| gi|558670386|ref|YP_008807096.1| gi|116048892|ref|YP_792307.1| gi|514408494|ref|YP_008131401.1| gi|558676737|ref|YP_008813445.1| 208963.PA14_51780 208964.PA0967 557722.PLES_43471 gi|568155492|ref|YP_008944481.1| gi|218893062|ref|YP_002441931.1| gi|392985555|ref|YP_006484142.1| gi|564954069|ref|YP_008886639.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]