SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for YFL017C from Saccharomyces cerevisiae VL3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YFL017C
Domain Number 1 Region: 1-155
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 8.54e-27
Family N-acetyl transferase, NAT 0.000000388
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) YFL017C
Sequence length 159
Comment GNA1 ORF Verified Evolutionarily conserved glucosamine-6-phosphate acetyltransferase required for multiple cell cycle events including passage through START, DNA synthesis, and mitosis; involved in UDP-N-acetylglucosamine synthesis, forms GlcNAc6P from AcCoA
Sequence
MSLPDGFYIRRMEEGDLEQVTETLKVLTTVGTITPESFSKLIKYWNEATVWNDNEDKKIM
QYNPMVIVDKRTETIAATGNIIIERKIIHELGLCGHIEDIAVNSKYQGQGLGKLLIGQLV
TIGFDYGCYKIILDCDEKNVKFYEKCGFNNAGVEMQIRK
Download sequence
Identical sequences A0A0L8VR51 B3LUJ2 C7GY93
YFL017C YFL017C YFL017C SCRT_05531 YFL017C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]