SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for YJR156C from Saccharomyces cerevisiae VL3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YJR156C
Domain Number 1 Region: 60-133
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 0.00000364
Family Phosphate binding protein-like 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) YJR156C
Sequence length 197
Comment THI11 ORF Verified Protein involved in synthesis of the thiamine precursor hydroxymethylpyrimidine (HMP); member of a subtelomeric gene family including THI5, THI11, THI12, and THI13
Sequence
MSPSTSSKVRLMLVLVSNVCNKSNWKSTWPSKADQLSDAKMLRIDKLACLGCCCFCTVLY
ICNDEFLKKNPEKVRKFLKAIKKATDYVLADPVKAWKEYIDFKPQLNNDLXYKQYQRCYA
YFSSSLYNVHRDWKKVTGYGKRLAILPPDYVSNYTNEYLSWPEPEEVSDPLEAQRLMAIH
QEKCRQEGTFKRLALPA
Download sequence
Identical sequences YJR156C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]