SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for YKL007W from Saccharomyces cerevisiae VL3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YKL007W
Domain Number 1 Region: 1-262
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 9.94e-83
Family Capz alpha-1 subunit 0.0000263
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) YKL007W
Sequence length 268
Comment CAP1 ORF Verified Alpha subunit of the capping protein (CP) heterodimer (Cap1p and Cap2p) which binds to the barbed ends of actin filaments preventing further polymerization; localized predominantly to cortical actin patches
Sequence
MSSSKFEEVINKIINDSPPGELREVYDDLIKITSENSKNTILDAIENYNVQNCIPIEVNG
NSVIISKYNKEGAKFFDPVNSVIFSVNHLERKGLDIEPYEFTHAKIEKGQLKELHDKLHE
YLLQSFPGDVSFAVYPVPEEISKISIIIVSTKYNPNNFWNGHWRSSYIYDLETRELSGQI
STQVHYYEDGNVSFQSGKDINQSNVDDVVCTIRDIETNFENDLDLSFFDLNEKQFKALRR
RLPVTRSKINWGSAIGSYRLGKNAAEGK
Download sequence
Identical sequences A0A0L8VLU2 A6ZZV8 B3LR77 B5VME6 C7GRG6 C8ZCF9 E7KF13 E7LWY8 E7QHD3 H0GJC0 N1P803 P28495
YKL007W YKL007W tr|A6ZZV8|A6ZZV8_YEAS7 SCRT_04013 YKL007W YKL007W YKL007W YKL007W YKL007W YKL007W YKL007W 354952 4932.YKL007W YKL007W YKL007W YKL007W YKL007W YKL007W YKL007W YKL007W YKL007W YKL007W YKL007W NP_012918.1.97178 YKL007W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]