SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for YNL332W from Saccharomyces cerevisiae VL3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YNL332W
Domain Number 1 Region: 2-185
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 1.21e-16
Family Phosphate binding protein-like 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) YNL332W
Sequence length 282
Comment THI12 ORF Verified Protein involved in synthesis of the thiamine precursor hydroxymethylpyrimidine (HMP); member of a subtelomeric gene family including THI5, THI11, THI12, and THI13
Sequence
MGLKAMIHTLAAKARGFPVTSVASLLDEPFTGVLYLKGSGITEDFQSLKGKKIGYVGEFG
KIQIDELTKHYGMKPEDYTAVRCGMNVAKYIIEGKIDAGIGIECMQQVELEEYLAKQGRP
ASDAKMLRIDKLACLGCCCFCTVLYICNDEFLKKNPEKVRKFLKAIKKATDYVLADPVKA
WKEYIDFKPQLNNDLSYKQYQRCYAYFSSSLYNVHRDWKKVTGYGKRLAILPPDYVSNYT
NEYLSWPEPEEVSDPLEAQRLMAIHQEKCRQEGTFKRLALPA
Download sequence
Identical sequences E7QJH5
YJR156C YDL244W YNL332W YFL058W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]