SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|385812126|ref|YP_005848517.1| from Lactobacillus fermentum CECT 5716

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|385812126|ref|YP_005848517.1|
Domain Number 1 Region: 208-592
Classification Level Classification E-value
Superfamily beta-lactamase/transpeptidase-like 7.63e-81
Family beta-Lactamase/D-ala carboxypeptidase 0.00000427
Further Details:      
 
Domain Number 2 Region: 66-256
Classification Level Classification E-value
Superfamily Penicillin binding protein dimerisation domain 9.94e-42
Family Penicillin binding protein dimerisation domain 0.0000124
Further Details:      
 
Domain Number 3 Region: 661-714
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.000000000144
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.0036
Further Details:      
 
Domain Number 4 Region: 602-659
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.0000000196
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|385812126|ref|YP_005848517.1|
Sequence length 718
Comment penicillin-binding protein 1 [Lactobacillus fermentum CECT 5716]
Sequence
MDKRQQKKRTINGENRRNRKTFGMWFFLVAAIIFILFTVRFSYIAIFKDVQNHNLKSQAA
KLYTSSQVIQAKRGTVYDADGNPIATDTSKYTVYAIIDSSYRSASGKALYVTNKKKTAKV
LAKYLDLSEAQILKILSPSSKGIFQVQFGTAGSNLSVATMEKIKKANLPGINFTQIPARE
YPEGNFASQLLGMTTLKTNTKTGTTQLVGDMGLEGYFNKQLTGTNGYRTVKQDVYGYQLA
DSSTKGRKVENGDNITTTLNNKVQHQMETLVSKVEKETQAEGITAIVMEAKTGKIVAATQ
RPNMKSETPSWTNALTQQTFEPGSTMKVLALAAAINSGNFDPNATYTSGTWSLGGGKITD
WVTSGWGTITYKEGFYRSSNVGFAHVEQNMGAKTWMKYIRRFGLLKKVNVYGMGNETAGY
TTFKGKLEQANTAYGQGITVNVMELMQAYTAIANNGKMVKPYWIEKVTDPNTGKTVKKLS
TTVVGHPISASTAKQVRKYMEGVIYNKVGTGQSYKVSGYRIAGKTGTAQIAGTNGYETGT
NDYIYSFAGFAPAKNPKYIIYLSMKKPKNLTKAAETHLSSISTPIIKYLLDQEKLKSEGQ
QGVVKVGNYVGKNAQTVQTSLAKKKLQVTVIGGNKKITAQSLTAGKEAIINSRLILKTSG
EMTMPDVSGWSQADVAQLAQMMGLKLSLTGSGYASNQSISVGTPVKAGDSLKVAYTGK
Download sequence
Identical sequences C0WXU6 D8IH92
gi|385812126|ref|YP_005848517.1| WP_003682138.1.58986 WP_003682138.1.82607

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]