SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|385812510|ref|YP_005848901.1| from Lactobacillus fermentum CECT 5716

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|385812510|ref|YP_005848901.1|
Domain Number 1 Region: 8-269
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 3.64e-79
Family Protein kinases, catalytic subunit 0.00000259
Further Details:      
 
Weak hits

Sequence:  gi|385812510|ref|YP_005848901.1|
Domain Number - Region: 494-554
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.00051
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.016
Further Details:      
 
Domain Number - Region: 425-486
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.0733
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|385812510|ref|YP_005848901.1|
Sequence length 640
Comment Serine/threonine protein kinase [Lactobacillus fermentum CECT 5716]
Sequence
MEPGYELNHRYRIIRPLGEGGMANVYLAHDLVLDRDVSVKLLRLDLRDDPNTQRRFHREA
LAATQLNDPHIVGVYDVGEDHGMQYMVMQYVKGMDLKAYIKQHYPLPLPQVVNIMEQVLA
AVEAAHAQGIIHRDLKPQNILIDDQQNIKITDFGIATASSGNSLTQTNTLLGSVHYLSPE
QARGSIATKRSDIYSLGIILYELLVGKVPFEGETAVSIALKHFRDRVPSVRQANPAIPQS
LENVVYRATAKDPAQRYGSAEEMAKDLKTVLTPERANEAPLVLXDPGDEETKVLDYRQIK
EAAAKTKQEPEAKEAPEQQETAPEQPPVPKKKRRRGLWVSLLTIVLAGLLGSGWYFNREV
TVPDLTGMTTAQATKALAKKHLRLGNITRETSSSVAKNRIVAVDGASKARYGREVNVILS
NGMKKWTMDDLVGNDYQGTAESLRAKGFTVRIKKEYSSSVSAGQIIRQSVSSGTVVHPAQ
DVITLTVSAGKQTYKIPNFKNEDITDVQDYASKHGLQLTVTQQESTTVAANKVISQTPKA
GSRLAKGDTLTVVIASSGTQLKTTSIQIDIPFDGNGGKTENRVQVYIEDAYHNLTMEYQD
ITINQETTINVPFTLRNGQTGAYKVIRNGKTIMSATNITG
Download sequence
Identical sequences D8IIC6
gi|385812510|ref|YP_005848901.1| WP_014562532.1.82607

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]