SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|385811818|ref|YP_005848209.1| from Lactobacillus fermentum CECT 5716

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|385811818|ref|YP_005848209.1|
Domain Number 1 Region: 34-278
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 1.81e-80
Family Phosphate binding protein-like 0.0000018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|385811818|ref|YP_005848209.1|
Sequence length 280
Comment ABC superfamily ATP binding cassette transporter, binding protein [Lactobacillus fermentum CECT 5716]
Sequence
MKNKNWIIWAVVAVVIVVIGWFSFGHSSQTSSKTVTVGVVGQTSQDEAIWKEIAKVAKDK
YGVTVKLKNFSDYNQPNKALQNGDVDLNAFQHQAFLDAWNKANKGTLVSIGKTFITPIHL
YSKKVTDVKDLPDGATIAVPNDASNESRALFLLKNAGLITLKTSAGSLATVKDIQDNPKN
LKIKEVAAEQTARTLDDVDAAVVNTNYAVAAKLPDSEIIYTEPVNKDSEQWINLIAAKKS
DANKEAYKDVVKAYHTSQVKKVIQKEYGNKEIPAWDLKLK
Download sequence
Identical sequences A0A1L7GV38 D8IGD4
WP_014562066.1.34248 WP_014562066.1.49422 WP_014562066.1.74232 WP_014562066.1.82607 WP_014562066.1.86783 WP_014562066.1.88712 WP_014562066.1.93965 gi|385811818|ref|YP_005848209.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]