SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|385812378|ref|YP_005848769.1| from Lactobacillus fermentum CECT 5716

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|385812378|ref|YP_005848769.1|
Domain Number 1 Region: 10-265
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 4.42e-52
Family Phosphate binding protein-like 0.00014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|385812378|ref|YP_005848769.1|
Sequence length 276
Comment amino acid ABC superfamily ATP binding cassette transporter substrate binding protein [Lactobacillus fermentum CECT 5716]
Sequence
MAWKKWLKMLMVAALVVMGAVSLAGCSSSSDSSVQDIKKKGELVVGTSADYPPYEFQIVK
NGKQQIVGYDVELAHLIAKNIGVKKVKFVNIAFPSLISELQNKKFDMVMAGMVWTKERAK
AVSFSSTYHHGGQVLLVSKANENKYSGISALKGATLGAQQSSEQETIGKSLSGVKLVTES
SITTLSQEVKAGTLDGLILAQTSADAFVAEHPNDYAIAKNITFKISAKTSDPRVVVRKSD
KALLKVVNKTIKDAKKSGELDKLFKEAQKLQYSNNQ
Download sequence
Identical sequences A0A0N7CPC0 A0A142KUE3 A0A1L7GXH1 C0WYF4 D8IHZ4 R4RX15 T0TNP8 V4XPZ5
gi|501674889|ref|YP_007995282.1| WP_003682939.1.10140 WP_003682939.1.25573 WP_003682939.1.49422 WP_003682939.1.55334 WP_003682939.1.58986 WP_003682939.1.82607 WP_003682939.1.82755 WP_003682939.1.86783 WP_003682939.1.88712 WP_003682939.1.9078 WP_003682939.1.93965 WP_003682939.1.94331 WP_003682939.1.99752 WP_003682939.1.99973 gi|385812378|ref|YP_005848769.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]