SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|385812504|ref|YP_005848895.1| from Lactobacillus fermentum CECT 5716

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|385812504|ref|YP_005848895.1|
Domain Number 1 Region: 34-283
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 7.72e-72
Family Phosphate binding protein-like 0.000045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|385812504|ref|YP_005848895.1|
Sequence length 291
Comment phosphate ABC transporter substrate-binding component [Lactobacillus fermentum CECT 5716]
Sequence
MKKIIGGLGVILVLLLGWGWFSARGNGATITKVTDVGSTALQPLAEAAIPGFNKTNPDVN
ITVQGGGSGTGLSQVQAGAVDIGSSDVFAAQQNGIDANKLVDHIVAVTGIVPIVNPKLGV
DNLSMSQLRDIFAGKITNWKEVGGPDEKITVINRASGSGTRLAFEQVVMDGQETMKAQEQ
DSNGTVKQIVSNVPGAISYVSSAYLNDQVKALTIDHVIATSENISDNKWKLWSYEHMYTT
KHAKKATLDYIKYLQSSDVQSHLVKEARYISIHDMKVQRDANGVVTKIGEK
Download sequence
Identical sequences A0A0F4HHT1 A0A142KTV4 D0DTV7 D8IIC0 R4RXN4
WP_004563249.1.10140 WP_004563249.1.25573 WP_004563249.1.36713 WP_004563249.1.47711 WP_004563249.1.49422 WP_004563249.1.49837 WP_004563249.1.50778 WP_004563249.1.56007 WP_004563249.1.74232 WP_004563249.1.74320 WP_004563249.1.77571 WP_004563249.1.81600 WP_004563249.1.82607 WP_004563249.1.82755 WP_004563249.1.86783 WP_004563249.1.9078 WP_004563249.1.94331 WP_004563249.1.99752 gi|501675124|ref|YP_007995517.1| gi|385812504|ref|YP_005848895.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]