SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for YER152C from Saccharomyces cerevisiae YPS163

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YER152C
Domain Number 1 Region: 6-434
Classification Level Classification E-value
Superfamily PLP-dependent transferases 1.6e-54
Family AAT-like 0.00031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) YER152C
Sequence length 443
Comment ORF Verified Protein with 2-aminoadipate transaminase activity; shares amino acid similarity with the aminotransferases Aro8p and Aro9p; YER152C is not an essential gene
Sequence
MKYKEINFFKGHPSSRLLPREAVIQATAAILGPETREYDNDPYNRHPLTYGSDEGALWVR
EQICTFLNDQLFKFENGARSRTRADYLNLNSGASYGMLNILLQTTLPHNGYTRQAFIITP
TYFLINNCFTDAGFKGKMTAINEQGHDSIDFESLISALEQHEAEPQPHSTTEMIQGPKLT
KKVYRYVMYCIPTFANPSGNTYSLETRRRLIDIARKYDMLIITDDVYDILDYTTPSDELP
SPPLRMVHIDRSTAPSGEDSFGNTVSNATFSKLIAPGLRFGYHESINANLARQLSKGGAN
VSGGTPSQLNSMIVGEMLRSGAAQRCIAHLRSVYSERATVLTSALKKYMPLGTEIMPLKG
GYFTWITLPPAYNAMEISTILAKKFNVILADGSNFEVIGDEKNWGQSCFRLSISFLEVDD
IDRGIELFGAVCKSHAITNNIIM
Download sequence
Identical sequences A0A250WJY2 C7GQ44
YER152C YER152C YER152C YER152C YER152C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]