SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for YFL030W from Saccharomyces cerevisiae YPS163

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YFL030W
Domain Number 1 Region: 7-361
Classification Level Classification E-value
Superfamily PLP-dependent transferases 1.5e-89
Family Cystathionine synthase-like 0.0000000000268
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) YFL030W
Sequence length 385
Comment AGX1 ORF Verified Alanine:glyoxylate aminotransferase (AGT), catalyzes the synthesis of glycine from glyoxylate, which is one of three pathways for glycine biosynthesis in yeast; has similarity to mammalian and plant alanine:glyoxylate aminotransferases
Sequence
MTKSVDTLLIPGPIILSGAVQKALDVPSLGHTSPEFVSIFQRVLKNTRAVFKSAAASKSQ
PFVLAGSGTLGWDIFASNFILSKAPNKNVLVVSTGTFSDRFADCLRSYGAQVDVVRPLKI
GESVPLELITEKLSQNSYGAVTVTHVDTSTAVLSDLKAISQAIKQTSPETFFVVDAVCSI
GCEEFEFDEWGVDFALTASQKAIGAPAGLSISLCSSRFMDYALNDSKNGHVHGYFSSLRR
WTPIMENYEAGKGAYFATPPVQLINSLDVALKEILEEGLHKRWDLHREMSDWFKDSLVNG
LQLTSVSRYPSNMSAHGLTAVYVADPPDVIAFLKSHGVVIAGGIHKDIGPKYIRIGHMGV
TACNKNLPYMKNCFDLIKLALQRKK
Download sequence
Identical sequences A0A250WMQ0 A7A209 B3LUI1 C7GY81 C8Z7Q3 E7KC19 E7LTY8 G2WDB1 N1PA19 P43567
SCRT_05518 YFL030W YFL030W YFL030W YFL030W YFL030W YFL030W YFL030w 2bkwA 2bkw_A YFL030W YFL030W YFL030W YFL030W YFL030W YFL030W YFL030W YFL030W YFL030W tr|A7A209|A7A209_YEAS7 4932.YFL030W NP_116623.1.97178 YFL030W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]