SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for YFR055W from Saccharomyces cerevisiae YPS163

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YFR055W
Domain Number 1 Region: 50-388
Classification Level Classification E-value
Superfamily PLP-dependent transferases 1.6e-81
Family Cystathionine synthase-like 0.000000377
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) YFR055W
Sequence length 394
Comment IRC7 ORF Uncharacterized Putative cystathionine beta-lyase; involved in copper ion homeostasis and sulfur metabolism; null mutant displays increased levels of spontaneous Rad52p foci; expression induced by nitrogen limitation in a GLN3, GAT1-dependent manner
Sequence
MIDRTELSKFGITTQLSVIGRNPDEQSGFVNPPLYKGSTIILKKLSDLEQRKGRFYGTAG
SPTIDNLENAWTHLTGGAGTVLSASGLGSISLALLALSKAGDHILMTDSVYVPTRMLCDG
LLAKFGVETDYYDPSIGKDIEKLVKPNTTVIFLESPGSGTMEVQDIPALVSVAKKHGIKT
ILDNTWATPLFFDAHAHGIDISVEAGTKYLGGHSDLLIGLASANEECWPLLRSTYDAMAM
LPGAEDCQLALRGMRTLHLRLKEVERKALDLAAWLGNRDEVEKVLHPAFEDCPGHEYWVR
DYKGSSGLFSIVLKNGFTRAGLEKMVEGMKVLQLGFSWGGYDSLITPVNPCNNRKASTWP
YKGFALRIQVGLEEFEDLKRDFELGFERLAENFL
Download sequence
Identical sequences YFR055W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]