SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for YHR112C from Saccharomyces cerevisiae YPS163

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YHR112C
Domain Number 1 Region: 55-373
Classification Level Classification E-value
Superfamily PLP-dependent transferases 6.89e-62
Family Cystathionine synthase-like 0.0000496
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) YHR112C
Sequence length 378
Comment ORF Uncharacterized Putative protein of unknown function; green fluorescent protein (GFP)-fusion protein localizes to the cytoplasm
Sequence
MVDLSTALIHGDDKDNRVTDVAPPINVSTTFRYDDDDLIPWTERENLDFMEKKPVYSRLA
HPNSTRLESIFSEILDGYAVIYSSGLAAFYAAMVHYNPKKIFIGQSYHGVRAIANILTRN
YGIEQHPLEDIEKCASEGDIVHLESPVNPYGTSSDIESLARRAHAKGALLIVDSTFASPP
LQYAWNFGADIVLYSATKYFGGHSDLLSGVLVVKEEATSRQLKDDRIYLGTNVANLESFM
LLRSLRTYEMRITKQSENATKLVRFLSDHQSEFDKVLKTIYHSSLQTEEFVKKQLVGGYG
PVFAITLYTKEQCKQLPLKLKYFHHATSLGGIESLVEWRAMTDPYIDQTLIRVSVGCESA
NDLIKDLASALKELQDAA
Download sequence
Identical sequences A0A0L8VPL7 A6ZT20 B3LSM7 C7GLZ8 G2WFI6 N1P289 P38716
YHR112C YHR112C YHR112C 4932.YHR112C YHR112C YHR112C YHR112C SCRT_04826 YHR112C NP_011980.1.97178 YHR112C YHR112C YHR112C YHR112C tr|A6ZT20|A6ZT20_YEAS7 YHR112C YHR112C YHR112C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]