SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for YIL116W from Saccharomyces cerevisiae YPS163

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YIL116W
Domain Number 1 Region: 6-379
Classification Level Classification E-value
Superfamily PLP-dependent transferases 5.64e-61
Family AAT-like 0.0000248
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) YIL116W
Sequence length 385
Comment HIS5 ORF Verified Histidinol-phosphate aminotransferase, catalyzes the seventh step in histidine biosynthesis; responsive to general control of amino acid biosynthesis; mutations cause histidine auxotrophy and sensitivity to Cu, Co, and Ni salts
Sequence
MVFDLKRIVRPKIYNLEPYRCARDDFTEGILLDANENAHGPTPVELSKTNLHRYPDPHQL
EFKTAMTKYRNKTSSYANDPEVKPLTADNLCLGVGSDESIDAIIRACCVPGKEKILVLPP
TYSMYSVCANINDIEVVQCPLTVSDGSFQMDTEAVLTILKNDPLIKLMFVTSPGNPTGAK
IKTSLIEKVLQNWDNGLVVVDEAYVDFCGGSTAPLVTKYPNLVTLQTLSKSFGLAGIRLG
MTYATAELARILNAMKAPYNISSLASEYALKAVQDSNLKKMEATSKIINEEKMRLLKELT
ALDYVDDQYVGGLDANFLLIRINGGDNVLAKKLYYQLATQSGVVVRFRGNELGCSGCLRI
TVGTHEENTHLIKYFKETLYKLANE
Download sequence
Identical sequences A0A250WM49 A6ZVG1 G2WG35
YIL116W YIL116W YIL116W tr|A6ZVG1|A6ZVG1_YEAS7 YIL116W YIL116W YIL116W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]