SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for YJL060W from Saccharomyces cerevisiae YPS163

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YJL060W
Domain Number 1 Region: 47-438
Classification Level Classification E-value
Superfamily PLP-dependent transferases 2.79e-93
Family AAT-like 0.00000212
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) YJL060W
Sequence length 444
Comment BNA3 ORF Verified Kynurenine aminotransferase, catalyzes formation of kynurenic acid from kynurenine; potential Cdc28p substrate
Sequence
MKQRFIRQFTNLMSTSRPKVVANKYFTSNTAKDVWSLTNEAAAKAANNSKNQGRELINLG
QGFFSYSPPQFAIKEAQKALDIPMVNQYSPTRGRPSLINSLIKLYSPIYNTELKAENVTV
TTGANEGILSCLMGLLNAGDEVIVFEPFFDQYIPNIELCGGKVVYVPINPPKELDQRNTR
GEEWTIDFEQFEKAITSKTKAVIINTPHNPIGKVFTREELTTLGNICVKHNVVIISDEVY
EHLYFTDSFTRIATLSPEIGQLTLTVGSAGKSFAATGWRIGWVLSLNAELLSYAAKAHTR
ICFASPSPLQEACANSINDALKIGYFEKMRQEYINKFKIFTSIFDELGLPYTAPEGTYFV
LVDFSKVKIPEDYPYPEEILNKGKDFRISHWLINELGVVAIPPTEFYIKEHEKAAENLLR
FAVCKDDAYLENAVERLKLLKDYL
Download sequence
Identical sequences G2WGV6 P47039
YJL060W YJL060W YJL060W 4932.YJL060W YJL060W YJL060W NP_012475.3.97178 YJL060W YJL060W YJL060W YJL060W YJL060W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]