SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for YLR027C from Saccharomyces cerevisiae YPS163

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YLR027C
Domain Number 1 Region: 3-410
Classification Level Classification E-value
Superfamily PLP-dependent transferases 1.72e-113
Family AAT-like 0.000000000000364
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) YLR027C
Sequence length 418
Comment AAT2 ORF Verified Cytosolic aspartate aminotransferase, involved in nitrogen metabolism; localizes to peroxisomes in oleate-grown cells
Sequence
MSATLFNNIELLPPDALFGIKQRYGQDQRATKVDLGIGAYRDDNGKPWVLPSVKAAEKLI
HNDSSYNHEYLGITGLPSLTSNAAKIIFGTQSDALQEDRVISVQSLSGTGALHISAKFFS
KFFPDKLVYLSKPTWANHMAIFENQGLKTATYPYWANETKSLDLNGFLNAIQKAPEGSIF
VLHSCAHNPTGLDPTSEQWVQIVDAIASKNHIALFDTAYQGFATGDLDKDAYAVRLGVEK
LSTVSPVFVCQSFAKNAGMYGERVGCFHLALTKQAQNKTIKPAVTSQLAKIIRSEVSNPP
AYGAKIVAKLLETPELTEQWHKDMVTMSSRITKMRHALRDHLVKLGTPGNWDHIVNQCGM
FSFTGLTPQMVKRLEETHAVYLVASGRASIAGLNQGNVEYVAKAIDEVVRFYATEAKL
Download sequence
Identical sequences A0A250WLY5 C7GXH3 C8ZCZ9 G2WIM1
YLR027C YLR027C YLR027C YLR027C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]