SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for YLR303W from Saccharomyces cerevisiae YPS163

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YLR303W
Domain Number 1 Region: 4-435
Classification Level Classification E-value
Superfamily PLP-dependent transferases 2.39e-117
Family Cystathionine synthase-like 0.00000000381
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) YLR303W
Sequence length 444
Comment MET17 ORF Verified Methionine and cysteine synthase (O-acetyl homoserine-O-acetyl serine sulfhydrylase), required for sulfur amino acid synthesis
Sequence
MPSHFDTVQLHAGQENPGDNAHRSRAVPIYATTSYVFENSKHGSQLFGLEVPGYVYSRFQ
NPTSNVLEERIAALEGGAAALAVSSGQAAQTLAIQGLAHTGDNIVSTSYLYGGTYNQFKI
SFKRFGIEARFVEGDDPEEFEKVFDERTKAVYLETIGNPKYNVPDFEKIVAIAHKHGIPV
VVDNTFGAGGYFCQPIKYGADIVTHSATKWIGGHGTTIGGIIVDSGKFPWKDYPEKFPQF
SQPAEGYHGTIYNEAYGNLAYIVHVRTELLRDLGPLMNPFASFLLLQGVETLSLRAERHG
ENALKLAKWLEQSPYVSWVSYPGLASHSHHENAKKYLSNGFGGVLSFGVKDLPNADKETD
PFKLSGAQVVDNLKLASNLANVGDAKTLVIAPYFTTHKQLNDKEKLASGVTKDLIRVSVG
IEFIDDIIADFQQSFETVFAGQKP
Download sequence
Identical sequences YLR303W YLR303W YLR303W YLR303W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]