SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for YOR184W from Saccharomyces cerevisiae YPS163

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YOR184W
Domain Number 1 Region: 9-393
Classification Level Classification E-value
Superfamily PLP-dependent transferases 1.1e-93
Family GABA-aminotransferase-like 0.00000102
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) YOR184W
Sequence length 395
Comment SER1 ORF Verified 3-phosphoserine aminotransferase, catalyzes the formation of phosphoserine from 3-phosphohydroxypyruvate, required for serine and glycine biosynthesis; regulated by the general control of amino acid biosynthesis mediated by Gcn4p
Sequence
MSLEREEPQHFGAGPAQMPTPVLQQAAKDLINFNDIGLGIGEISHRSKDATKVIEDSKKH
LIELLNIPDTHEVFYLQGGGTTGFSSVATNLAAAYVGKHGKIAPAGYLVTGSWSQKSFEE
AKRLHVPAEVIFNAKDYNNGKFGKIPDESLWEDKIKGKAFSYVYLCENETVHGVEWPELP
KCLVNDPNIEIVADLSSDILSRKIDVSQYGVIMAGAQKNIGLAGLTLYIIKKSILKNISG
ASDETLHELGVPITPIAFDYPTVVKNNSAYNTIPIFTLHVMDLVFQHILKKGGVEAQQAE
NEEKAKILYEALDANSDFYNVPVDPKCRSKMNVVFTLKKDGLDDQFLKEAAARHLTGLKG
HRSVGGFRASIYNALSVKAVQNLVDFIKEFAEKNA
Download sequence
Identical sequences A0A250WAV3 G2WN57 N1NWQ6 P33330
YOR184W NP_014827.3.97178 YOR184W YOR184W 4932.YOR184W YOR184W YOR184W YOR184W YOR184W YOR184W YOR184W YOR184W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]