SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|385813569|ref|YP_005849962.1| from Lactobacillus helveticus H10

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|385813569|ref|YP_005849962.1|
Domain Number 1 Region: 9-272
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 7.01e-85
Family Protein kinases, catalytic subunit 0.00000338
Further Details:      
 
Weak hits

Sequence:  gi|385813569|ref|YP_005849962.1|
Domain Number - Region: 430-488
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.000113
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.019
Further Details:      
 
Domain Number - Region: 506-566
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.00017
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.012
Further Details:      
 
Domain Number - Region: 364-425
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.017
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|385813569|ref|YP_005849962.1|
Sequence length 671
Comment Kinase domain protein [Lactobacillus helveticus H10]
Sequence
MIDKGYLLGERYRIIDTLGEGGMANVYLAEDIILQRKVAVKILRLDLQNEPQTQARFKRE
ALATSELSHPNIVSAFDVGTDHGLHYMVMEYVDGPDLKEYIRQNAPLDLHEVIRIMDQIL
SAVALAHKHNVIHRDLKPQNILMDKRGNIKIADFGIAVALNQSSVTQTNSVMGSVHYMSP
EQTRGGLVTKQSDIYSLGIILYELITGTVPFNGDTPVSIALKHAQEPIPSIRKKDHSVPQ
ALENVVLKATAKDPRDRYATAQAMQADLDSSLDPERADEPVFVPNHGNNNDKTIVLPGFK
APEKEQPTESDEETKPDKKEKKKDFWQNVKSHKWWWIFSIIATGLIIFIMIFALSGSNNK
PHQVHIPDVTNITEKSAEKKLEAAGLQIGKVVKRQSDDIKKGHVIGTKPAAGNSMDQGKA
IILIVSSGSSMVKVPNVVGDNYYEAAEKLENQGFDVVREDQYSNKVARDNIISQSIAAGV
EVKPTQTTITLVVSRGKQVKPKINTVTLKDLHNYSLKSAQDYAKEHGLTLQINQEYSDEV
EKGLVISMQPEAGTKVERGSTVTIKVSRGPKEEKDTTITKTFTVNYIGTDLNKDDKSDSK
SGDASNKEDSSKGDHVQIYIKDDDHSLSNIYRDLYIKRDMSFSIPFSLKNGNGQLRVVRN
RETVLNEKVTK
Download sequence
Identical sequences F0NS30 U4QJ33
WP_014563387.1.36150 WP_014563387.1.42949 gi|385813569|ref|YP_005849962.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]