SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|385814088|ref|YP_005850481.1| from Lactobacillus helveticus H10

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|385814088|ref|YP_005850481.1|
Domain Number 1 Region: 256-600
Classification Level Classification E-value
Superfamily beta-lactamase/transpeptidase-like 2.33e-83
Family beta-Lactamase/D-ala carboxypeptidase 0.000000706
Further Details:      
 
Domain Number 2 Region: 65-255
Classification Level Classification E-value
Superfamily Penicillin binding protein dimerisation domain 6.15e-46
Family Penicillin binding protein dimerisation domain 0.0000347
Further Details:      
 
Domain Number 3 Region: 604-662
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.0000000000113
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.0088
Further Details:      
 
Domain Number 4 Region: 665-719
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.0000000000157
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|385814088|ref|YP_005850481.1|
Sequence length 720
Comment penicillin-binding protein 1 [Lactobacillus helveticus H10]
Sequence
MKKNSNLKLQKSKAHSYRFTVGRVLQVAVALVFLVFTARFLYIGISKTVNGQNLSQRTKQ
LYKRNEVIKASRGTIYDCNGLAIAEDSHLYTVYAILDKSSINYKNKPEYVVNKSETAEKL
AKVLPLSADKIYQYLNPKHKAFQVQFGTGGSGLTLKQKKQIEAMKLPGIKFVATPSRLYP
NGNFASHIVGLAQPEYNKKTNSEMLVGTMGLEAYFNDTLTGKDGYRISTVDASENQSPNQ
NQVYKPVENGNNLYLTLNSQLQSYLEARLTEVQKAYDPTSITAVVEDMKTGKILAASQRP
TFNPQTKKGLTKSYRNILVQDTYEPGSVFKVLSFAAAVNSGNYNPNEYYRSGSVSIGGST
IHDWLTSGWGTIPFSQAFERSSNTGFVKLEQKMGSKTWKKYLKRFHIGEKTGITLPGEQP
GFISFKTPVDQAVTAFGQGVNVNVMQMMQAYSSLGNNGQMVKPQLVDKVTDFNNGKTIKG
YQIKKVGAPIYSAKIKRVVLANMRKVLNKQSGTGSAYKMGNADIGVKTGTAQIANPKGGG
YLKGDSNYIFSVVGVYPTKNPRYCIYLTIKQPHLAGTTAEKILASIFKPMMSRIITMAKS
NNSTTTVTVPNFKDMTVAQASAEAKQLGLNLVKVGEKDKITAQGIKSGEKLESGDKIFVY
TSGKINCPDMKGWSFNDLHQFSNVSGVKLSIKGTGTVASQSVAKGTELKSGEKIKVNLKE
Download sequence
Identical sequences F0NU42
WP_014563830.1.42949 gi|385814088|ref|YP_005850481.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]