SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|385826349|ref|YP_005862691.1| from Lactobacillus johnsonii DPC 6026

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|385826349|ref|YP_005862691.1|
Domain Number 1 Region: 2-113
Classification Level Classification E-value
Superfamily YheA/YmcA-like 3.53e-31
Family YheA-like 0.0051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|385826349|ref|YP_005862691.1|
Sequence length 117
Comment hypothetical protein [Lactobacillus johnsonii DPC 6026]
Sequence
MVNIYDNANQLAKDLQETEQFKDLKKSLENLKNNPESLDLYQRMDKLQQQILAAQNSGQP
LSEEAQKEYQKINEEVRNNDELKDMITKEQALFQMINDVQQAMTKPIGDLYDDLKAK
Download sequence
Identical sequences A0A1B3PTR6 F4AGS7 F7SF18 Q74I89
gi|42519554|ref|NP_965484.1| 257314.LJ1677 gi|385826349|ref|YP_005862691.1| WP_004897829.1.13362 WP_004897829.1.24787 WP_004897829.1.27409 WP_004897829.1.27769 WP_004897829.1.28348 WP_004897829.1.40168 WP_004897829.1.43572 WP_004897829.1.46682 WP_004897829.1.58924 WP_004897829.1.64510 WP_004897829.1.65350

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]