SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|385825142|ref|YP_005861484.1| from Lactobacillus johnsonii DPC 6026

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|385825142|ref|YP_005861484.1|
Domain Number 1 Region: 7-104
Classification Level Classification E-value
Superfamily Enzyme IIa from lactose specific PTS, IIa-lac 2.09e-37
Family Enzyme IIa from lactose specific PTS, IIa-lac 0.00025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|385825142|ref|YP_005861484.1|
Sequence length 108
Comment PTS system transporter subunit IIA cellobiose specific [Lactobacillus johnsonii DPC 6026]
Sequence
MAQENSDNMQVVMGIIMQAGNAKAAAMQAIQAAKKGDFEKADEFIKQANEGLVNAHNVQT
DMLTQEAQGNHVKVDLYMVHAQDHLMTAITFIDLAKEVVAVYKKMAEK
Download sequence
Identical sequences A0A137PNP2 A0A256LDT4 F4ADS8 F7SGQ1 Q74LJ5 V5P134
gi|560151549|ref|YP_008844347.1| gi|42518276|ref|NP_964206.1| 257314.LJ0190 WP_004898685.1.101245 WP_004898685.1.13362 WP_004898685.1.13956 WP_004898685.1.16003 WP_004898685.1.21921 WP_004898685.1.22120 WP_004898685.1.24787 WP_004898685.1.27409 WP_004898685.1.27769 WP_004898685.1.28348 WP_004898685.1.32843 WP_004898685.1.33722 WP_004898685.1.3786 WP_004898685.1.40168 WP_004898685.1.43572 WP_004898685.1.46682 WP_004898685.1.52277 WP_004898685.1.54950 WP_004898685.1.56141 WP_004898685.1.57595 WP_004898685.1.58924 WP_004898685.1.59164 WP_004898685.1.60789 WP_004898685.1.63737 WP_004898685.1.63928 WP_004898685.1.64510 WP_004898685.1.65350 WP_004898685.1.68093 WP_004898685.1.68558 WP_004898685.1.7250 WP_004898685.1.76328 WP_004898685.1.78892 WP_004898685.1.79545 WP_004898685.1.79574 WP_004898685.1.89814 WP_004898685.1.94402 WP_004898685.1.99270 gi|385825142|ref|YP_005861484.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]