SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|338204184|ref|YP_004650329.1| from Lactobacillus reuteri SD2112

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|338204184|ref|YP_004650329.1|
Domain Number 1 Region: 207-602
Classification Level Classification E-value
Superfamily beta-lactamase/transpeptidase-like 1.82e-82
Family beta-Lactamase/D-ala carboxypeptidase 0.00000236
Further Details:      
 
Domain Number 2 Region: 64-255
Classification Level Classification E-value
Superfamily Penicillin binding protein dimerisation domain 8.11e-43
Family Penicillin binding protein dimerisation domain 0.0000323
Further Details:      
 
Domain Number 3 Region: 603-658
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.000000000000249
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.004
Further Details:      
 
Domain Number 4 Region: 661-714
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.00000000000523
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|338204184|ref|YP_004650329.1|
Sequence length 719
Comment penicillin-binding protein C [Lactobacillus reuteri SD2112]
Sequence
MNKKPQRTKNRGHRENRGTFGKWLFLITVGLFTLFIVRFAYIAINKDVQHVNLRSQAEQI
YTQQRIIQARRGDIYDSEGNPLATDTSKYTLYAVLDRTQKSSDGKPLYVKDRKKTAKVLS
QYIDLTPKQIEKILKPKGQAYQVEFGNAGSNLSVSTMQKIKNRHLPGINFIATPARQYPE
GEFASQIIGMATPKVKNDNGTEETNLVGQLGLEGYFNKQLTGINGLRKDKQDVYGYQIAN
SKQVTKKAVNGDNIYTTLDSQTQHFLENKVNKVYKSSNANAMTAVVMEAKTGKIIAATQR
PTLHAENNPVWRNMLVQDAYEPGSVMKILSLAAAIDTGHFNPNATFNSGTWAMGGGKITD
WSSSGWGTISYKDAFDMSSNVGFAHVEQDMGAETWMKYIKRFGLLKKVNVIGMSNEVNGY
TSFKGILVQANTAFGQGITVNVMQMMQAFSAIGNNGKMMKPYIVSKVVDGNSGKTIQKVK
PKVVGHPIKASTAKKVLGYMQGVVYDQKGLGHDYQIKGYRIAGKTTTAQIGGAHGYSTGD
TNYLYSFAGMAPAKNPKYIMYVTLRQPQNLKKTATKQIASVFNPTMKMLLSQQKVAEKVK
KKVITMPNVVGQASDEANKELSGKGMQVIVVGSGKKVKQQSAVPDEQVLTDQHVILDTGG
EYKMPDVSGWSSADVQQLAKALKLKVKENGNGYVTQQSILPDTTIKRGTTLTVQYEAKN
Download sequence
Identical sequences F8DNH7
WP_003671808.1.101197 WP_003671808.1.15271 WP_003671808.1.46412 WP_003671808.1.73577 gi|338204184|ref|YP_004650329.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]