SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|338203375|ref|YP_004649520.1| from Lactobacillus reuteri SD2112

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|338203375|ref|YP_004649520.1|
Domain Number 1 Region: 42-292
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 0.00000000000000454
Family L-arabinose binding protein-like 0.0091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|338203375|ref|YP_004649520.1|
Sequence length 331
Comment ABC transporter binding protein [Lactobacillus reuteri SD2112]
Sequence
MKRMYSLIAIIIAFLCFAFFRENNGFVTKQRIPKVGVLTLMHHPALDEIYKGYVDELAKE
GYHNGKNIKIEYQNANGDQSNLKTMASKLVDDNSTVLFGITTPAAQALANSTTKTPIVLG
AVTDPKTAGLVKNNQHPGGNITGVSDQAPIREQLNLIKQFMPRMKILGVIYTSSDASAVA
GYHQIKRECRKMNINLKAYSIANSNDLNQVSEQMLSQVDAVIVPTDNTIAGAMQTLVKNA
DAANKPVFPATDTMVKQGGVATYSVNQRALGVQGAKMTVAILKGKSKPADTPIEYMKHGT
PVLNIKQARKLNLQIPAQFEKDAETKGEVYK
Download sequence
Identical sequences A0A1Y3U319 A0A2A7QEL7 A0A2A7R3U6 F8DQK4
WP_003669786.1.101197 WP_003669786.1.15271 WP_003669786.1.46412 WP_003669786.1.47704 WP_003669786.1.73577 WP_003669786.1.96669 gi|338203375|ref|YP_004649520.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]