SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|338203535|ref|YP_004649680.1| from Lactobacillus reuteri SD2112

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|338203535|ref|YP_004649680.1|
Domain Number 1 Region: 37-241
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 0.000000000000103
Family L-arabinose binding protein-like 0.0061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|338203535|ref|YP_004649680.1|
Sequence length 332
Comment ABC transporter binding protein [Lactobacillus reuteri SD2112]
Sequence
MEIGMKRIMGYIIIGIVVIGGYFGLLRLHQQTTKPVVGILTMMHHPALDQIQKGLVAGLA
EEGYRNGKNIKIEYQNANGDQGNLNTMANKLVNDHAKVIVGITTPACQALANATKDIPIV
MGGIGDPVGAGLVKNEKHPEGNVTGVHDVNPSEQQIALVKKFIPNIKTLGVIYTSSDTSS
ESQYRTMVKAAHKLHVNLKTYTIANANELNQTSQTMLSKVDAVIVPSDNTIAGSMGVLVK
NADAVNKPVFPSADTMVKDGGVASISLSQYGQGKAAGKITARILKGEKPGQMAVNNYHHG
EPVLNLKQARKLGIKVPADFQREAEQHGTVFK
Download sequence
Identical sequences F8DR67
gi|338203535|ref|YP_004649680.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]