SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for psu|TvY486_0043740 from Trypanosoma vivax

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  psu|TvY486_0043740
Domain Number - Region: 69-108
Classification Level Classification E-value
Superfamily ApbE-like 0.0575
Family ApbE-like 0.068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) psu|TvY486_0043740
Sequence length 172
Comment | organism=Trypanosoma_vivax | product=hypothetical protein, conserved in T. vivax | location=TvY486_bin_contig_7965:2888-3403(+) | length=172
Sequence
VGIKMDSVGVGACKIKFSHMISGSLTDAFGNVARLNAKVLRDTNDVFIRVGERNKNISQS
LYDMNTGANSADGSVMRTAKHELDAKAVAKATIVDPVSRMLKDMCTFKTLLCSMQHYATL
LMTRSSSIERNALDQEAKAAAMWKGIVRVAELPLPVGWCFEMAWKRMEMLDD
Download sequence
Identical sequences psu|TvY486_0043740

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]