SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for psu|TvY486_0500500 from Trypanosoma vivax

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  psu|TvY486_0500500
Domain Number 1 Region: 377-651,804-887
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 4.76e-53
Family Succinate dehydrogenase/fumarate reductase flavoprotein N-terminal domain 0.0000906
Further Details:      
 
Domain Number 2 Region: 43-339
Classification Level Classification E-value
Superfamily ApbE-like 6.02e-53
Family ApbE-like 0.00086
Further Details:      
 
Domain Number 3 Region: 640-804
Classification Level Classification E-value
Superfamily Succinate dehydrogenase/fumarate reductase flavoprotein, catalytic domain 9.27e-34
Family Succinate dehydrogenase/fumarate reductase flavoprotein, catalytic domain 0.0004
Further Details:      
 
Domain Number 4 Region: 1002-1126
Classification Level Classification E-value
Superfamily Ferredoxin reductase-like, C-terminal NADP-linked domain 1.44e-28
Family Reductases 0.001
Further Details:      
 
Domain Number 5 Region: 896-982
Classification Level Classification E-value
Superfamily Riboflavin synthase domain-like 0.0000000000000681
Family Ferredoxin reductase FAD-binding domain-like 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) psu|TvY486_0500500
Sequence length 1142
Comment | organism=Trypanosoma_vivax | product=NADH-dependent fumarate reductase, putative | location=TvY486_05:167539-170967(+) | length=1142
Sequence
MADGRSSASTVVTDPEKAARERDALARAFLQDSPQSAPMQYAVSGLELTVPYVIKVVTSA
EEFDRARNVTDEVLRSAWQLADAVLNNFNPDSEVSLIGKLPVGRCHQMSAPLKRVIACCL
RVYNTSGGSFDPASGPIVDALRNVVMGKQTSSGEIEVLVQSCTLSNSFVIDMREGTIARK
HEYARLDLGGVSKGYIVDYVVESLNAAAFPNVFFEWGGDCRASGTNARNGPWIVGITRPP
PLDELCNVKRDAAYISVVRLENEALATSGDYENLLVTPNKEFFTTIYDWKTKSLLAPSHT
NISQVTVKCYSAMYADALATACLVKRDPVKVRYMLDGWRHVRDAVKDYILYIRENERVAK
MFEIATENPEMRKKRILNSLPARVIVVGGGLAGLSAAIEAAGCGAQVILLEKEGRLGGNS
AKATSGINGWGTRAQAKAGIMDGGKYFERDTYKSGVGGNTDPALVKTLSMKSADAISWLT
SLGVPLTVLSQLGGHSRKRTHRAPDTTDGTPMPIGHTIMKVLENHIRSNLSDRVTIMTNS
SVTELLNERREHPDGSVQVRVTGVKIRHGDGDETQILADAVILATGGFSNDKTSDSLLRE
YAPDLPGFPTTNGPWATGDGVKLARRLGAKLVDMDKIQLHPTGLINPKDPANPTKFLGPE
ALRGSGGILLNKQGKRFVNELGLRSAVSRAIIQQKNEYPGSNGSHFAYCVLNDAARQLFG
VGTHDFYWKRAGLFVKADTVGSLAALIGCPVETLQETLEEYERLSKARQRCPVTHKSVYP
CTLGPQGPYYVAFATPSIHYTMGGCLISPSAEVQMEDTSYRSPLSRTRSILGLFGAGEVT
GGVHGGNRLGGNSLLECVVFGKIAGDRAATILQKKKNSLSFTLWTTVVLREVLEGGMYGV
GSRVLRFNLPGALQVSGLSLGQFIAIRGEWDGQQLIGYYSPITLPDDPGVIGILARSDRG
NLREWISALEPGDAVEMKGCGGLVIERRFKEEHFVFSGHVINKLCLIAGGTGVAPMLQII
QAALRPPFIDTMDSVHLIYAAEDVSELTYREVLEEYRRNSRGKFKKTFVLNHPPPLWTDG
VGFVDKVILSNHVQSPADNLLVVICGPPVMQRAVKHNLKGLGYNMYLVRTVDETDSKMHS
KI
Download sequence
Identical sequences G0TV75
psu|TvY486_0500500

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]