SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for psu|TvY486_0801450 from Trypanosoma vivax

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  psu|TvY486_0801450
Domain Number 1 Region: 118-309
Classification Level Classification E-value
Superfamily ApbE-like 0.00000178
Family ApbE-like 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) psu|TvY486_0801450
Sequence length 710
Comment | organism=Trypanosoma_vivax | product=conserved hypothetical protein | location=TvY486_08:446925-449057(+) | length=710
Sequence
MASWNPKSYIAEALSRYTMEAVKSNDESTIPSYYDAMTHHLRSYELSKDVQSVLDCQEAS
NANFSMQICDAKFQVLFNPVNAFATPTLNRDIKNIIDTILVSFYVILSESVNLRLSKGTA
VLSPVLFDILKNARDLSLATNYPLGVCEEMVYGSDVASSRLKSFHSMKLYEDSKVLLPDD
LAVNIDKFVEAWLVDNVFDGLRSITGISGCCVTYKGFSRVFGAPHHSSVWKCAVWGYGAS
GEQIVIGSVELDDEHPAMATYTLQNHSSDPFGMHSCTAHCQKVATAYALARVLHSHKGKE
TALRFVSEWRKKYKENPNLLLLRFSLFFGYGKQTSDEADNFVGEGDAERLIPYDKEVVLS
EAQKHMESIGHYAAQASRVVMKANDIDAVHHLMAIHDCKVNKELDKVFSFLPTICVAATF
VVKTGSLFVNILNTVELFRDDGICTFSVPKGSLMYNYVFESGSQITLNIFHENGPIHQNI
NNRGSLWVNEEGNDVVVVEKDGTRCITTKILQCISTQIIFETSKCLYIGDDLFVVGRLLS
KIPNNILVKMGGSYMPKSIYPSQDLYPFIFTTLHKLYGTVGLVGYGSKLCALNPPVVSIC
CSSELSDIVLGEGNTGTRCRITFLSRAGSCIYSGKTFDELNRCLPIASNDVCSIPSENIA
FFLQGTVMHVLREFSPRFVICLITVSNVTVNTTDVGVLNISYDSQPVKGV
Download sequence
Identical sequences G0U0D8
psu|TvY486_0801450

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]