SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|385835491|ref|YP_005873265.1| from Lactobacillus rhamnosus ATCC 8530

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|385835491|ref|YP_005873265.1|
Domain Number 1 Region: 8-270
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.29e-83
Family Protein kinases, catalytic subunit 0.00000217
Further Details:      
 
Weak hits

Sequence:  gi|385835491|ref|YP_005873265.1|
Domain Number - Region: 503-561
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.000262
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.01
Further Details:      
 
Domain Number - Region: 426-482
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.00837
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.016
Further Details:      
 
Domain Number - Region: 359-421
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.0196
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|385835491|ref|YP_005873265.1|
Sequence length 666
Comment lipopolysaccharide kinase family protein [Lactobacillus rhamnosus ATCC 8530]
Sequence
MIEPGTILNERYKLIKTLGEGGMANVYLARDLILDRDVAVKVLRLDLQNDPDTVRRFQRE
AIATSELVHPNIVSIYDVGESHGQQFLVMEYVKGSDLKHYIVEHFPIPYQRVVDMMEQIL
SAVQTAHDHNIIHRDLKPQNILIDPDGNAKITDFGIAVALSENSMTMTNSLLGSVHYLSP
EQARGSMPTRQSDIYALGIILFEMLTGSVPFEGDSAVSIALKHFQEEIPSVRAFDPHIPQ
ALENVVFKATAKNPANRYTSADAMASDLSTALSPARAHEAKYVIPKDDLDETRIVPVIPN
GPKPPHDDDDHANQPAEHHSPDGQAKKKRRRWLMIGLSALIVMLILVGIGLVTANQKADV
TVPDLRGMTKTQAKTALTSSRLKVGKYRYTYSTKVDRDLVIDSSPKRQVSVKEGSAVDLI
LSRGQPRITLDNYVGQDYTDAKSDLQKRGVTVKEKVVRTNSVAAGKITAQSIKPGKKVIA
SKTTITFDVAEPIKKVNTAFALRDLTGYTEKSLRDYANEVGLKIVIAQSHSDTVDTGMVI
SQNPAAGTQVHAGDTVNVTISQGPDPDELKTVTKTISIPYQAPASSSTTSGSGSSSGSAS
SSGPTPNGVQVFIGDKTHNIDSVDKTFNITADNQVTITLQVNKTYPGSYRVVRDGTVVAQ
EYNITQ
Download sequence
Identical sequences A0A2G9IZV0 C2JXU0
WP_005689658.1.32073 WP_005689658.1.41093 WP_005689658.1.45310 WP_005689658.1.70502 gi|385835491|ref|YP_005873265.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]