SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|435845580|ref|YP_007307830.1| from Natronococcus occultus SP4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|435845580|ref|YP_007307830.1|
Domain Number 1 Region: 13-244
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 4.8e-56
Family DNA replication initiator (cdc21/cdc54) N-terminal domain 0.0000393
Further Details:      
 
Domain Number 2 Region: 334-449,477-515
Classification Level Classification E-value
Superfamily Hedgehog/intein (Hint) domain 2.62e-35
Family Intein (protein splicing domain) 0.0041
Further Details:      
 
Domain Number 3 Region: 1104-1286
Classification Level Classification E-value
Superfamily Hedgehog/intein (Hint) domain 9.29e-32
Family Intein (protein splicing domain) 0.0021
Further Details:      
 
Domain Number 4 Region: 542-661,756-772,1000-1064
Classification Level Classification E-value
Superfamily Hedgehog/intein (Hint) domain 4.12e-31
Family Intein (protein splicing domain) 0.0015
Further Details:      
 
Domain Number 5 Region: 1287-1508
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3.4e-17
Family Extended AAA-ATPase domain 0.019
Further Details:      
 
Domain Number 6 Region: 857-962
Classification Level Classification E-value
Superfamily Homing endonucleases 0.00000000000000808
Family Intein endonuclease 0.012
Further Details:      
 
Weak hits

Sequence:  gi|435845580|ref|YP_007307830.1|
Domain Number - Region: 276-333
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.000337
Family Extended AAA-ATPase domain 0.063
Further Details:      
 
Domain Number - Region: 762-835
Classification Level Classification E-value
Superfamily Homing endonucleases 0.014
Family Group I mobile intron endonuclease 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|435845580|ref|YP_007307830.1|
Sequence length 1586
Comment putative ATPase involved in replication control, Cdc46/Mcm family [Natronococcus occultus SP4]
Sequence
MAQAGNSELVDSFEQFFRNYYDNEIKQLAQQYPNEQRSLHVDWQDLYRYDPNLADDFLAQ
PEQLQRYAEEALRLYDLPIDVSLGQAHVRVHNLPETESPEIRDIRARDMNSLVQVRGIVR
KATDVRPKIEEAAFECQLCGTLTRVPQSSGDFQEPHECQGCERQGPFRVNFDQSEFVDSQ
KLRIQESPEGLRGGETPQSLDVHVEDDITGEVTPGDHVSATGVLRLEQQGDGQDKSPVFD
FYMEGMAVDIDEEQFEDMDITEEDKEEIVRLSSSDDIYEQMVGSIAPSIYGYEQEKLAMI
LQLFSGVTKQLPDGSRIRGDLHMLLIGDPGTGKCVRGDTKVTLADGRNVPIRDLVEANIE
DPKPIDDGWYDEIDLEVPSLQDDGSIAPQRATKVWKREAPDQMYQIRTSSGRELEVTPSH
PLFVGVADGYRAIRADELSVGDSIAVTTGSANTVDQPTVNEVPVLADGGTVASTSAVADQ
INSIETVDPDYDWVYDLEIEGTHNYVSNGIISHNSQMLGYIQNIAPRSVYTSGKGSSSAG
LCVTGETLIHTEDGFRQAKDVATTRLPDPVDTETAVEDEIGLYTFDRDSGALETRSTSHV
WRMPPKECRRIETARGKELEASQSTPVLTCGEDGLEWTQISNVEAGDYVAVPKYDEVDRS
TPPIEDYLEFTNEKLKLADESIVQIRRQLCETYGTLRDAAAELDLSEDFVYDTIRNRHIP
IAKLERVLEGIDLELDQLSVERAMLRHGDGVRIPDEFDEDLCYLLGLVFGDGDIRLSRRD
GNRGLVRISNSDETILERAVEIVDDTFDKRPEIEYQDDRVPCIRVHSATIAQLFSNAGME
TPKEDLKLDPALTTAEHADAFLRGLMDADGSVSSRTDGGSSIHFSTISQEFAEQVQLMLE
TYGVRSRVRERDRRGVSVLENGYEIESNHVQYHLECYGRNIERYADAIGFGYPTKRAALE
EIVGDATRREEKIPVGTTLATVDAAGGEYYMNLNRGDNPGRGRARRMLEEVDLGDAEPIV
EEAVEADLCWDEVVAAVDTGEKEVFDLTVPETHNFLANGVVTHNTAAAVRDDFGDGQQWT
LEAGALVLADQGIAAVDELDKMRCVTGESLVELSNGSSIAIEEIAQQAAKAGEIEPLENG
RTMRNVDVSVRTMTDSGAIVERPVTAVHQYETPSELIEVITEDGEKLRSTPDHPFFIRQD
GSTIERSATNLEVGDRTLVPCNESSIVTDGGAVMTDQSARSSLHDVEPSEIVKIHRIDGD
EWDYVYDLTVEGTHNFIANGMVVHNSEDRSAMHEALEQQKISVSKAGINATLKSRCSLLG
AANPKYGRFDQYEPIGEQIDLEPALISRFDLIFTVTDQPDEEKDKNLAEHILTTNYAGEL
TTQREEMTSLEVSEEEIEEMTEQVDPVIDAELLRKYIAYAKQNCHPRMTEDARETIRDFY
VDLRAKGTDEDAPVPVTARKLEALVRLSEASARVRLSDTVEQRDAERVVEIVRSCLQDIG
VDPETGEFDADIVEAGTSKSQRDRIKNIKGLISDIEEEYDEGAPVDIVLERADEIGMDES
KAEHEIDKLKQKGEVYEPSTDTLRTT
Download sequence
Identical sequences L0JUS0
WP_015319497.1.9138 gi|435845580|ref|YP_007307830.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]