SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|435845853|ref|YP_007308103.1| from Natronococcus occultus SP4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|435845853|ref|YP_007308103.1|
Domain Number 1 Region: 11-88
Classification Level Classification E-value
Superfamily Homeodomain-like 0.0000000000000077
Family Tetracyclin repressor-like, N-terminal domain 0.0062
Further Details:      
 
Domain Number 2 Region: 88-205
Classification Level Classification E-value
Superfamily Tetracyclin repressor-like, C-terminal domain 0.0000000000000572
Family Tetracyclin repressor-like, C-terminal domain 0.0069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|435845853|ref|YP_007308103.1|
Sequence length 209
Comment transcriptional regulator [Natronococcus occultus SP4]
Sequence
MGGTSGGKRSMTLGEDLDETTAAIMDAVYRALSRNGYPETTMSEIAAEFEKSKSLLYYHY
ESKEEILNDFFAHLCEHLEATLVEDAPDDPYEQLLALIDRLLPAEMDNEALRFRRAFFEI
RSQAPHNQSYHEQIKRSDEIVLEALTETIRRGVEEGRFVDVDPEREAELLFSTSYGIMER
GVALEDRSLIERNRATLYDRIERWLLEAE
Download sequence
Identical sequences L0JWV4
WP_015319769.1.9138 gi|435845853|ref|YP_007308103.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]