SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|435846438|ref|YP_007308688.1| from Natronococcus occultus SP4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|435846438|ref|YP_007308688.1|
Domain Number 1 Region: 49-320
Classification Level Classification E-value
Superfamily Galactose oxidase, central domain 1.7e-41
Family Galactose oxidase, central domain 0.0061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|435846438|ref|YP_007308688.1|
Sequence length 328
Comment hypothetical protein Natoc_1053 [Natronococcus occultus SP4]
Sequence
MSEDDGDRTLLTRRRAIAGGGLLALGGATAWAFRPAPVDDSEGWSERATMPTERGEMNGA
VLEDRIHVPGGLTGLGDTTDRMDIYDPVADEWENAASMPEPLNHHAAATIEDVLYVVGGN
REFDDPPEDHVFEYDPDADAWTERGPLPEGRWGHELVAYDGRLYLVGGHTTDSHDVLIFD
GETWDRGEPIPTPRDHLAAGALDDRVLTVSGRWDGDNDPTVEAYDPDADAWEAIDAAPTP
RSGTAGTVVDGRFHLGGGEDPAVVTGWTTDSHEVFDGEEWTTVPELPLSLHGPTAVSYDG
AFYVVGGAWRQGALSATAWSDRTFVYEP
Download sequence
Identical sequences L0JYH0
gi|435846438|ref|YP_007308688.1| WP_015320351.1.9138

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]