SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|435846692|ref|YP_007308942.1| from Natronococcus occultus SP4

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|435846692|ref|YP_007308942.1|
Domain Number - Region: 144-190
Classification Level Classification E-value
Superfamily Homeodomain-like 0.00276
Family Homeodomain 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|435846692|ref|YP_007308942.1|
Sequence length 222
Comment putative DNA binding protein [Natronococcus occultus SP4]
Sequence
MGGTVAEIELSPAEFVLEETIDDIEGLECEGERIVANADGEVMPFLWVDAPDLEGIEAAF
ESDETVDNVQLLADVDGERLYQMDWVRRVDALVQMLVEEEGTVLSAAGDADGWQFRLLFP
DRDSLSRTNDYCRSNGIRFTLHSVYSLEEGRQGRFGLTDDQQDTLEMAFERGYYQIPREA
DMMALAEEIDISHQALSERLRRAHRSLVQNTVVIGQDGDPGE
Download sequence
Identical sequences L0JVU6
gi|435846692|ref|YP_007308942.1| WP_015320602.1.9138

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]