SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|435846992|ref|YP_007309242.1| from Natronococcus occultus SP4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|435846992|ref|YP_007309242.1|
Domain Number 1 Region: 3-99
Classification Level Classification E-value
Superfamily GlnB-like 2.74e-31
Family Divalent ion tolerance proteins CutA (CutA1) 0.00014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|435846992|ref|YP_007309242.1|
Sequence length 100
Comment uncharacterized protein involved in tolerance to divalent cations [Natronococcus occultus SP4]
Sequence
MPTVYITAPPEDAPSIAETLLEERLAACVNELSATSTYRWEGEVHRDEEAVLLAKTTDDA
YDELVDRVRELHPYDVPCIERFDEADVLESFADWRADSVE
Download sequence
Identical sequences L0JWQ2
gi|435846992|ref|YP_007309242.1| WP_015320899.1.9138

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]