SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|435847592|ref|YP_007309842.1| from Natronococcus occultus SP4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|435847592|ref|YP_007309842.1|
Domain Number 1 Region: 6-159
Classification Level Classification E-value
Superfamily Resolvase-like 2.49e-30
Family gamma,delta resolvase, catalytic domain 0.00074
Further Details:      
 
Weak hits

Sequence:  gi|435847592|ref|YP_007309842.1|
Domain Number - Region: 185-219
Classification Level Classification E-value
Superfamily Homeodomain-like 0.00717
Family Tetracyclin repressor-like, N-terminal domain 0.063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|435847592|ref|YP_007309842.1|
Sequence length 229
Comment site-specific recombinase, DNA invertase Pin [Natronococcus occultus SP4]
Sequence
MTTGTTAIYVRVSTQKQELEIQKQNCWDYCIEDLNVEPSDIEVYEDKATGANLKRDGYDE
LMQDAENGEVSRVVVREVSRFARNMRDLNRTIGRLCDDNNAAVHVLDSGLQINEGEEQDG
LFDDRLVMQILGIAAELEHKLTKERTKAGLQAAKEAGKHTGRPPYGFETDNEGYLVPDED
YDTARAVIDLVEEDGESIRAASRHTGVARSTIRNIIKRKDMYLDGIDLD
Download sequence
Identical sequences L0JYC1
WP_015321495.1.9138 gi|435847592|ref|YP_007309842.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]