SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|435848095|ref|YP_007310345.1| from Natronococcus occultus SP4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|435848095|ref|YP_007310345.1|
Domain Number 1 Region: 66-209
Classification Level Classification E-value
Superfamily PRTase-like 5.51e-23
Family Phosphoribosyltransferases (PRTases) 0.042
Further Details:      
 
Weak hits

Sequence:  gi|435848095|ref|YP_007310345.1|
Domain Number - Region: 5-35
Classification Level Classification E-value
Superfamily Homeodomain-like 0.0376
Family Tetracyclin repressor-like, N-terminal domain 0.067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|435848095|ref|YP_007310345.1|
Sequence length 216
Comment orotate phosphoribosyltransferase-like enzyme [Natronococcus occultus SP4]
Sequence
MKNVDDLIESAAELANQGLSKGEIADELNVSRETASWLVERSGTTAEPSTQTAEPSGDAG
GPQDIHVDWSAIGRDSKRMGAIAEAMADLLAKHGEDVDLTVGIEKAGGPIATLVASELET
DLSTYTPAKHQWEEGDIEELGGTFSRNFAGIRDRECYIVDDTITSGTTMRETISAIRAEG
GEPLACVVLADKQGVEEIEGVPVYSLLQVISVGKDE
Download sequence
Identical sequences L0K1W7
WP_015321994.1.9138 gi|435848095|ref|YP_007310345.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]