SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|435848697|ref|YP_007310947.1| from Natronococcus occultus SP4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|435848697|ref|YP_007310947.1|
Domain Number 1 Region: 1085-1252
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 1.44e-58
Family DNA gyrase/MutL, second domain 0.0000185
Further Details:      
 
Domain Number 2 Region: 117-235,642-677
Classification Level Classification E-value
Superfamily Hedgehog/intein (Hint) domain 2.09e-26
Family Intein (protein splicing domain) 0.0078
Further Details:      
 
Domain Number 3 Region: 27-110
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 9.58e-17
Family DNA gyrase/MutL, N-terminal domain 0.0042
Further Details:      
 
Domain Number 4 Region: 436-523
Classification Level Classification E-value
Superfamily Homing endonucleases 0.00000000323
Family Intein endonuclease 0.059
Further Details:      
 
Domain Number 5 Region: 682-799
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 0.000000347
Family DNA gyrase/MutL, N-terminal domain 0.0021
Further Details:      
 
Weak hits

Sequence:  gi|435848697|ref|YP_007310947.1|
Domain Number - Region: 809-854
Classification Level Classification E-value
Superfamily S13-like H2TH domain 0.073
Family Topoisomerase VI-B subunit middle domain 0.0076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|435848697|ref|YP_007310947.1|
Sequence length 1385
Comment DNA topoisomerase VI, subunit B [Natronococcus occultus SP4]
Sequence
MTSFQSTLGEEPGIAEELAESQQAISIAEFFEKNKHMLGFDSGARGLVTAVKEAVDNALD
AAEEAGILPDIYVEIQESGDYYTLIVEDNGPGLTKESLPKVFGKLLYGSRFHAREQSLTP
DQRLLVRRNGTIEFVPIGVLCDAYLPEEGEGTAPIAGQIEAPSFNRETHEMTWEPVTHAI
RHETDEQTYEITTQKGRTVEVTGNHSVFSVTKDGATKEIKAGELEPGDVLLTPRRLPSPD
ETVEKVNVLEHLSAEQFEDRRVYVYGFDTETLEELRTGETIRKRPSEDSSRERYYYRYDG
VDILRDSLEQNYLEKGYLPAELVLELGWEEKAADCSFKTYQAGGDETTMPVTLPIDDSFV
ELVAHYISEGHVGQRQVGFTFGAHESELIESTEQAVQGITGSTTTVERERNSTRVKAFGS
PLAMFLESVCGCSADEKRIPEFVFQAPAEHQRDFIAALYQGDGSDSHPSNELSHTTTSET
LARQLSVLWNMHGVLASTETLSDRPGYADDPKTAYRTKVYGEDASLSDVFSTARNTGEQG
YKRVPTSLLEDVRVGDVESETVPDTVPGLLMGAGVGSSIEHADVYRSLIEASLDGEDVEK
PRYVHTLKEKGLLDADHQPTDRLEALWETVHNIHGLTDTDMCLLPVTDVEATDPPEYVYD
VSVPGATGADENFVVANQGALSVKNSRGQQGIGISAAVLYSQLTSGKPAKITSRTQGSSE
AEYFELIVDTDENEPEISVEETTSWDRPHGTRIELEMEGNMRARQQLHDYIKHTAVVNPH
ARLELKEPNAHFKFERGTDQLPEETEEIRPHPHGVELGTVIKMLSATDSQTISGFLQEEF
TRVGKKTADSVIDAFRDRHYGREMRWHIPDASEDIDLRAAVSDATANKGAEATAAFADAI
ADAVADRERIAHHELLDLVAEAADDVENEHGTAFGETVQENAANAGWNALIDAPEETADP
DEDAVAESRLVTDCYEIADEATTTRKDDEVIHGFASRLAARFEDEDDDRHRLTRRQLRAH
VDRAADLTEEYDDVSFGDTARENVTDAVWDVMATVPDDPPLVRELAGDRDATSDLVDAMR
ATDIMAPPTRCLSPITDDLIRAGLEKEFDADFYAAATRDAEVHSGDPFIVEAGIAYGGDI
PAEGSADVMRFANRVPLVYQRGACATTDVVKSIGWRNYGLDQPGGSGLPNGPAVIMVHVA
STNVPFTSESKDAVANVPAIEDEIELAIREAARELKSFLNKRRSMEKRRKKQNVLGKILP
EMAEKVAEVTDREEPEIDDAIARIMNNVLVERHIEANGDGQAVSVVVENHSSTNETLEVT
DIVSAEPRNLSADATAVEMDGEWFVKWEPEVSSEDEAVLEYEIDDDAAFDLDVKGVEGAK
LTVNQ
Download sequence
Identical sequences L0K1G7
WP_015322592.1.9138 gi|435848697|ref|YP_007310947.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]