SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|435848827|ref|YP_007311077.1| from Natronococcus occultus SP4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|435848827|ref|YP_007311077.1|
Domain Number 1 Region: 18-135
Classification Level Classification E-value
Superfamily Homeodomain-like 0.000000000000762
Family Recombinase DNA-binding domain 0.072
Further Details:      
 
Weak hits

Sequence:  gi|435848827|ref|YP_007311077.1|
Domain Number - Region: 246-334
Classification Level Classification E-value
Superfamily Ribonuclease H-like 0.0455
Family DnaQ-like 3'-5' exonuclease 0.077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|435848827|ref|YP_007311077.1|
Sequence length 367
Comment transposase [Natronococcus occultus SP4]
Sequence
MSGDRRKEIVRHLSEDDLDRLLAESTDEKLTERLIFIKRVYKGATLEDAADDVGRSSATG
TRWARRWNKGGLGLLMPNFGGGRPPKLGEDQRELLLELLRDGQPWKKQEIQHLINEEFDV
EFHPVYLSTFLEDLGLSYAIPRTKHPSRPENAEEILDERVADAFDEGTDEPHNQREGDEE
EGWVVDKEIRTDGGTILGFLDTSHLQPWDNSQRLYTVDDPYITRPLVKLDEPAVGFYALS
GESVIQFPANQEKERICGCFEGIREQNPGQRILLVLDNFSSHVCEYTRRRAHQLGIDLVF
LPVGSPDLNPIEQVWKSLKWEASPLIVESAAEYRALLTELFKQLTTQLSFAVSWIDEHLG
GYLQKLR
Download sequence
Identical sequences L0K1X7
WP_015322721.1.9138 gi|435848827|ref|YP_007311077.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]