SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|435849443|ref|YP_007311631.1| from Natronococcus occultus SP4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|435849443|ref|YP_007311631.1|
Domain Number 1 Region: 117-206
Classification Level Classification E-value
Superfamily Tetracyclin repressor-like, C-terminal domain 0.00000000000000166
Family Tetracyclin repressor-like, C-terminal domain 0.0039
Further Details:      
 
Domain Number 2 Region: 12-76
Classification Level Classification E-value
Superfamily Homeodomain-like 0.0000000000000349
Family Tetracyclin repressor-like, N-terminal domain 0.0092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|435849443|ref|YP_007311631.1|
Sequence length 211
Comment transcriptional regulator [Natronococcus occultus SP4]
Sequence
MSNSDQFVAEQTDTVDVIMQSTYCVLQEHGYANLSIAKIADEAELSKSALYNHYDGKNEL
LLDFLSRFLDWFLESLSDGETQDPQEDLMRLIDLFSIDPGAESNSIGGVLDETAIDAFIE
LRAQAIHDEAFRRELLREDEAIHDRIVQIIRRGIADGVFRDVDPDSVAEFILTVLEGALF
RYSLMNDATARDVYDQLDEYIDAQLKKRSLE
Download sequence
Identical sequences L0K4A7
gi|435849443|ref|YP_007311631.1| WP_015323272.1.9138 gi|435849443|ref|YP_007311631.1|NC_019976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]