SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|523518980|ref|YP_008205060.1| from Lactobacillus rhamnosus LOCK908

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|523518980|ref|YP_008205060.1|
Domain Number 1 Region: 13-95
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 1.08e-20
Family ArsR-like transcriptional regulators 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|523518980|ref|YP_008205060.1|
Sequence length 97
Comment putative transcriptional regulator [Lactobacillus rhamnosus LOCK908]
Sequence
MDIKQSVITENFKQRLFFALSDPGRYKIVRMLYHVGHEMGCNELNEHVEIDKSTMSYHLR
TLREIGMITTRTQGRQKFVTLNREKIEAAFPGLLERL
Download sequence
Identical sequences A0A0D6UDN9 A0A1F0RQ08 A0A249N714 A0A2A5L7Z7 C2K0Y4 K8QGW9
gi|258507515|ref|YP_003170266.1| gi|523518980|ref|YP_008205060.1| gi|258507515|ref|YP_003170266.1| gi|523516070|ref|YP_008202152.1| 568703.LGG_00520 568704.LC705_00511 gi|385834449|ref|YP_005872223.1| WP_005684269.1.100 WP_005684269.1.100405 WP_005684269.1.100905 WP_005684269.1.101361 WP_005684269.1.101629 WP_005684269.1.10611 WP_005684269.1.11050 WP_005684269.1.12139 WP_005684269.1.14005 WP_005684269.1.14021 WP_005684269.1.14188 WP_005684269.1.14284 WP_005684269.1.14484 WP_005684269.1.14979 WP_005684269.1.15430 WP_005684269.1.16044 WP_005684269.1.16842 WP_005684269.1.18223 WP_005684269.1.18502 WP_005684269.1.18871 WP_005684269.1.23805 WP_005684269.1.24248 WP_005684269.1.25484 WP_005684269.1.27841 WP_005684269.1.3013 WP_005684269.1.30532 WP_005684269.1.32073 WP_005684269.1.32471 WP_005684269.1.33665 WP_005684269.1.36367 WP_005684269.1.36475 WP_005684269.1.36928 WP_005684269.1.37365 WP_005684269.1.37924 WP_005684269.1.39501 WP_005684269.1.40906 WP_005684269.1.41093 WP_005684269.1.42644 WP_005684269.1.4294 WP_005684269.1.43381 WP_005684269.1.43697 WP_005684269.1.44898 WP_005684269.1.45310 WP_005684269.1.46331 WP_005684269.1.48411 WP_005684269.1.49488 WP_005684269.1.49891 WP_005684269.1.50473 WP_005684269.1.51358 WP_005684269.1.51722 WP_005684269.1.52120 WP_005684269.1.53572 WP_005684269.1.53665 WP_005684269.1.56295 WP_005684269.1.57122 WP_005684269.1.57153 WP_005684269.1.57217 WP_005684269.1.57253 WP_005684269.1.58801 WP_005684269.1.59185 WP_005684269.1.60726 WP_005684269.1.61450 WP_005684269.1.62246 WP_005684269.1.62275 WP_005684269.1.62506 WP_005684269.1.63053 WP_005684269.1.63979 WP_005684269.1.65997 WP_005684269.1.67031 WP_005684269.1.67264 WP_005684269.1.67395 WP_005684269.1.67667 WP_005684269.1.68137 WP_005684269.1.68272 WP_005684269.1.70097 WP_005684269.1.70398 WP_005684269.1.70401 WP_005684269.1.70502 WP_005684269.1.70613 WP_005684269.1.71250 WP_005684269.1.71459 WP_005684269.1.72024 WP_005684269.1.73229 WP_005684269.1.7391 WP_005684269.1.75513 WP_005684269.1.76218 WP_005684269.1.76241 WP_005684269.1.76540 WP_005684269.1.77423 WP_005684269.1.78781 WP_005684269.1.80214 WP_005684269.1.80670 WP_005684269.1.8089 WP_005684269.1.81670 WP_005684269.1.8195 WP_005684269.1.84719 WP_005684269.1.85245 WP_005684269.1.85765 WP_005684269.1.85933 WP_005684269.1.86216 WP_005684269.1.87473 WP_005684269.1.87509 WP_005684269.1.90835 WP_005684269.1.91456 WP_005684269.1.9147 WP_005684269.1.91665 WP_005684269.1.92011 WP_005684269.1.93242 WP_005684269.1.93450 WP_005684269.1.94635 WP_005684269.1.95093 WP_005684269.1.95170 WP_005684269.1.96492 WP_005684269.1.97125 WP_005684269.1.9713 WP_005684269.1.98686 WP_005684269.1.9911 WP_005684269.1.99535 gi|258538702|ref|YP_003173201.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]