SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|523519004|ref|YP_008205084.1| from Lactobacillus rhamnosus LOCK908

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|523519004|ref|YP_008205084.1|
Domain Number 1 Region: 8-107
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 6.75e-26
Family HxlR-like 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|523519004|ref|YP_008205084.1|
Sequence length 114
Comment Transcriptional regulator, MarR family [Lactobacillus rhamnosus LOCK908]
Sequence
MSGELYDCAAGCPVQNTVDIISGKWKSVILYHLFQGDATRFSTLNKAIPSVTERMLALQL
AQLEADHVITKKPGDADGRATEYGLTEFGQTLAPVIQAMATWGEAYQARQKATA
Download sequence
Identical sequences A0A0D6UF92 A0A1F0RQH7 A0A2A5L8D2
WP_005684245.1.100 WP_005684245.1.100405 WP_005684245.1.100905 WP_005684245.1.101629 WP_005684245.1.10611 WP_005684245.1.11050 WP_005684245.1.12139 WP_005684245.1.14005 WP_005684245.1.14021 WP_005684245.1.14188 WP_005684245.1.14284 WP_005684245.1.14484 WP_005684245.1.14979 WP_005684245.1.15430 WP_005684245.1.16044 WP_005684245.1.16842 WP_005684245.1.18223 WP_005684245.1.18502 WP_005684245.1.18871 WP_005684245.1.23805 WP_005684245.1.24248 WP_005684245.1.25484 WP_005684245.1.27841 WP_005684245.1.3013 WP_005684245.1.30532 WP_005684245.1.33665 WP_005684245.1.36367 WP_005684245.1.36475 WP_005684245.1.36928 WP_005684245.1.37365 WP_005684245.1.37924 WP_005684245.1.39501 WP_005684245.1.40906 WP_005684245.1.42644 WP_005684245.1.4294 WP_005684245.1.43381 WP_005684245.1.43697 WP_005684245.1.44898 WP_005684245.1.45310 WP_005684245.1.46331 WP_005684245.1.48411 WP_005684245.1.49488 WP_005684245.1.49891 WP_005684245.1.50473 WP_005684245.1.51722 WP_005684245.1.52120 WP_005684245.1.53572 WP_005684245.1.53665 WP_005684245.1.56295 WP_005684245.1.57122 WP_005684245.1.57153 WP_005684245.1.57217 WP_005684245.1.57253 WP_005684245.1.58801 WP_005684245.1.59185 WP_005684245.1.60726 WP_005684245.1.61450 WP_005684245.1.62246 WP_005684245.1.62275 WP_005684245.1.62506 WP_005684245.1.63053 WP_005684245.1.63979 WP_005684245.1.65997 WP_005684245.1.67031 WP_005684245.1.67264 WP_005684245.1.67395 WP_005684245.1.67667 WP_005684245.1.68137 WP_005684245.1.68272 WP_005684245.1.70097 WP_005684245.1.70398 WP_005684245.1.70401 WP_005684245.1.70502 WP_005684245.1.70613 WP_005684245.1.71250 WP_005684245.1.71459 WP_005684245.1.72024 WP_005684245.1.72055 WP_005684245.1.73229 WP_005684245.1.7391 WP_005684245.1.75513 WP_005684245.1.76218 WP_005684245.1.76241 WP_005684245.1.76540 WP_005684245.1.77423 WP_005684245.1.78781 WP_005684245.1.79700 WP_005684245.1.80214 WP_005684245.1.80670 WP_005684245.1.8089 WP_005684245.1.81670 WP_005684245.1.8195 WP_005684245.1.84719 WP_005684245.1.85245 WP_005684245.1.85765 WP_005684245.1.85933 WP_005684245.1.86216 WP_005684245.1.87473 WP_005684245.1.87509 WP_005684245.1.90835 WP_005684245.1.91456 WP_005684245.1.9147 WP_005684245.1.91665 WP_005684245.1.92011 WP_005684245.1.93242 WP_005684245.1.93450 WP_005684245.1.94635 WP_005684245.1.95093 WP_005684245.1.95170 WP_005684245.1.96492 WP_005684245.1.97125 WP_005684245.1.9713 WP_005684245.1.98686 WP_005684245.1.9911 WP_005684245.1.99535 WP_005684245.1.99828 gi|258507538|ref|YP_003170289.1| gi|258538724|ref|YP_003173223.1| 568703.LGG_00543 568704.LC705_00533 gi|523519004|ref|YP_008205084.1| gi|258507538|ref|YP_003170289.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]