SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|523519234|ref|YP_008205314.1| from Lactobacillus rhamnosus LOCK908

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|523519234|ref|YP_008205314.1|
Domain Number 1 Region: 281-476
Classification Level Classification E-value
Superfamily ITPase-like 1.02e-63
Family ITPase (Ham1) 0.0000135
Further Details:      
 
Domain Number 2 Region: 109-258
Classification Level Classification E-value
Superfamily Aspartate/glutamate racemase 3.6e-39
Family Aspartate/glutamate racemase 0.00039
Further Details:      
 
Domain Number 3 Region: 5-107
Classification Level Classification E-value
Superfamily Aspartate/glutamate racemase 1.8e-34
Family Aspartate/glutamate racemase 0.00011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|523519234|ref|YP_008205314.1|
Sequence length 484
Comment Glutamate racemase/Nucleoside 5-triphosphatase RdgB (dHAPTP, dITP, XTP-specific) [Lactobacillus rhamnosus LOCK908]
Sequence
MNKQPIGFIDSGVGGLTVVKEALHQLPAENTIYLGDQARLPYGPRPAEQVQAFTWQMVNF
LLTKHIKMLVIACNTATAAALPLIKARLKIPVIGVIKPGSRAALKATQTGHIGIIATEGT
VKSGAYPKALRAKAPNIRLTSLAAPKFVSLVESNEAHSPIAKRVVADTLQPLLHQDIDTL
VLGCTHYPILRPIIQNVMGEDVTLIDSGAETVNDVSMLLDYFDLANDGSEVPTHTYYTTG
APSMFDELGESWLELKKPMHAQHVDIDTQPTHFVEPTSEATDKTIVIASKNPGKIKEFKA
MFEPAGVTVKSLADFPTVPTVDETGTTFEANARQKADQYAQDLNLPVLADDSGLMVDALD
GQPGIRSARYAGDGHNDAANNAKLLAALADVPEEARTATFHTTLVLAKPNHPEADLVVHG
DLSGRITAIPRGTDGFGYDPFFLVPALDKTLAELTADEKNEISHRGNAMRALEKVWQAWL
EENV
Download sequence
Identical sequences A0A1F0RXE2 A0A2G9ITA9
WP_014571192.1.12139 WP_014571192.1.14021 WP_014571192.1.16044 WP_014571192.1.16842 WP_014571192.1.18871 WP_014571192.1.24248 WP_014571192.1.25484 WP_014571192.1.27841 WP_014571192.1.32073 WP_014571192.1.36928 WP_014571192.1.37924 WP_014571192.1.41093 WP_014571192.1.43381 WP_014571192.1.43697 WP_014571192.1.44898 WP_014571192.1.45310 WP_014571192.1.53665 WP_014571192.1.56295 WP_014571192.1.57153 WP_014571192.1.59185 WP_014571192.1.60726 WP_014571192.1.67031 WP_014571192.1.70097 WP_014571192.1.70401 WP_014571192.1.70502 WP_014571192.1.70613 WP_014571192.1.71250 WP_014571192.1.72024 WP_014571192.1.76218 WP_014571192.1.8089 WP_014571192.1.81670 WP_014571192.1.84719 WP_014571192.1.85765 WP_014571192.1.86216 WP_014571192.1.87473 WP_014571192.1.87509 WP_014571192.1.9147 WP_014571192.1.93242 WP_014571192.1.94635 WP_014571192.1.97125 WP_014571192.1.98686 WP_014571192.1.99535 gi|258538968|ref|YP_003173467.1| 568704.LC705_00777 gi|523519234|ref|YP_008205314.1| gi|385834697|ref|YP_005872471.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]