SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|523519275|ref|YP_008205355.1| from Lactobacillus rhamnosus LOCK908

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|523519275|ref|YP_008205355.1|
Domain Number 1 Region: 9-138
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 1.22e-38
Family FUR-like 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|523519275|ref|YP_008205355.1|
Sequence length 146
Comment Peroxide stress regulator PerR, FUR family [Lactobacillus rhamnosus LOCK908]
Sequence
MNQAVYNKTINLLKAKQIRVTPQREAIISYMIDSTAHPTAEMIYAKLSPQFPHMSVATVY
NNLRLLVDLNLVEEMSSNDAATHFDFPIEPHYHAICTNCGKIFDFTYPGVTDVEAVAAKK
TGFKVSGHHLEVYGICPECQIKLGMK
Download sequence
Identical sequences A0A0E3CKR3 A0A1F0S6S6 A0A249N888 A0A2A5L1R7 C2JT22 K8QDG7
gi|523519275|ref|YP_008205355.1| 568703.LGG_00831 gi|258507826|ref|YP_003170577.1| gi|385834737|ref|YP_005872511.1| gi|258507826|ref|YP_003170577.1| WP_005688075.1.100 WP_005688075.1.100405 WP_005688075.1.100905 WP_005688075.1.101361 WP_005688075.1.101629 WP_005688075.1.10611 WP_005688075.1.12139 WP_005688075.1.14005 WP_005688075.1.14021 WP_005688075.1.14188 WP_005688075.1.14484 WP_005688075.1.14979 WP_005688075.1.15430 WP_005688075.1.18871 WP_005688075.1.23805 WP_005688075.1.24248 WP_005688075.1.27841 WP_005688075.1.3013 WP_005688075.1.32073 WP_005688075.1.32471 WP_005688075.1.33665 WP_005688075.1.36367 WP_005688075.1.36475 WP_005688075.1.37365 WP_005688075.1.37924 WP_005688075.1.39501 WP_005688075.1.40906 WP_005688075.1.41093 WP_005688075.1.42644 WP_005688075.1.4294 WP_005688075.1.43697 WP_005688075.1.44898 WP_005688075.1.45310 WP_005688075.1.46331 WP_005688075.1.49488 WP_005688075.1.49891 WP_005688075.1.50473 WP_005688075.1.51358 WP_005688075.1.51722 WP_005688075.1.53572 WP_005688075.1.53665 WP_005688075.1.56295 WP_005688075.1.57122 WP_005688075.1.57217 WP_005688075.1.57253 WP_005688075.1.58801 WP_005688075.1.62246 WP_005688075.1.62275 WP_005688075.1.62506 WP_005688075.1.63053 WP_005688075.1.63979 WP_005688075.1.65997 WP_005688075.1.67031 WP_005688075.1.67395 WP_005688075.1.67667 WP_005688075.1.68137 WP_005688075.1.68272 WP_005688075.1.70097 WP_005688075.1.70398 WP_005688075.1.70401 WP_005688075.1.70502 WP_005688075.1.71250 WP_005688075.1.71459 WP_005688075.1.72024 WP_005688075.1.72055 WP_005688075.1.73229 WP_005688075.1.7391 WP_005688075.1.75513 WP_005688075.1.76241 WP_005688075.1.77423 WP_005688075.1.78781 WP_005688075.1.80214 WP_005688075.1.8089 WP_005688075.1.8195 WP_005688075.1.85245 WP_005688075.1.85765 WP_005688075.1.85933 WP_005688075.1.86216 WP_005688075.1.87473 WP_005688075.1.90835 WP_005688075.1.91456 WP_005688075.1.9147 WP_005688075.1.91665 WP_005688075.1.92011 WP_005688075.1.93450 WP_005688075.1.94635 WP_005688075.1.95093 WP_005688075.1.95170 WP_005688075.1.96492 WP_005688075.1.97125 WP_005688075.1.9713 WP_005688075.1.98686 WP_005688075.1.9911

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]